KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0613Help
Entry
DIP0613           CDS       T00151                                 

Definition
(GenBank) Putative membrane protein
  KO
K09167  uncharacterized protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    DIP0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bPH_2 DUF4191
Motif
Other DBs
NCBI-ProteinID: CAE49130
UniProt: Q6NJ03
Position
582222..582692
Genome map
AA seq 156 aa AA seqDB search
MMLMGSTMNAVSPKLVKARYWAVVPFLVVTILGSAASAVFLWSWMWIVTGVWVAILAWAV
WLIPAQVRRIGWREDPDELLITKGKLWRTLTVVPYGRLQFVDVQEGPIARRCGLAEVEIH
TASSTSDASIAGLPVADAYALRQRLTDKARERLSGL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttatgggtagcacaatgaatgcggtgtcgccaaagctggtgaaagctcgatat
tgggcagtggtgccttttctcgttgtgacgatactaggaagcgctgcgtccgctgtcttt
ttgtggtcatggatgtggatcgtcacaggggtgtgggtggcgattttggcgtgggctgta
tggctgattccagcacaggtgcgcaggatagggtggcgcgaagatcccgacgaactgctg
attacgaagggtaaattgtggcgaactctcaccgtggttccttatgggcgtttgcagttc
gtggacgttcaagaagggcctattgcgaggcgttgtggtcttgcagaagtagagatccac
acggcatcgtcgacaagcgatgccagcatcgcgggtcttccggtcgcggacgcgtatgcg
ttgcgtcagcgactaaccgataaagcgcgcgagaggcttagcgggctatga

DBGET integrated database retrieval system