KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0623Help
Entry
DIP0623           CDS       T00151                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00270  Cysteine and methionine metabolism
cdi00920  Sulfur metabolism
cdi01100  Metabolic pathways
cdi01110  Biosynthesis of secondary metabolites
cdi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DIP0623 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DIP0623 (metX)
Enzymes [BR:cdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DIP0623 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     DIP0623 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF4884 Esterase
Motif
Other DBs
NCBI-ProteinID: CAE49140
UniProt: Q6NIZ3
Position
complement(591014..592117)
Genome map
AA seq 367 aa AA seqDB search
MLTTTGTLTHQKIGDFYTEAGATLHDVTIAYQAWGHYTGTNLIVLEHALTGDSNAISWWD
GLIGPGKALDTNRYCILCTNVLGGCKGSTGPSSPHPDGKPWGSRFPALSIRDLVNAEKQL
FDHLGINKIHAIIGGSMGGARTLEWAALHPHMMTTGFVIAVSARASAWQIGIQTAQISAI
ELDPHWNGGDYYSGHAPWEGIAAARRIAHLTYRGELEIDERFGTSAQHGENPLGPFRDPH
QRFAVTSYLQHQGIKLAQRFDAGSYVVLTEALNRHDIGRGRGGLNKALSAITVPIMIAGV
DTDILYPYHQQEHLSRNLGNLLAMAKISSPVGHDAFLTEFRQMERILRHFMELSEGIDDS
FRTKLER
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaccacagggacgctcacgcaccaaaaaatcggagacttttacaccgaagcc
ggagcgacgcttcacgacgtaaccatcgcctaccaagcatggggccactacaccggcacc
aatctcatcgttctcgaacatgccctgaccggcgactctaacgctatttcatggtgggac
ggactgattggccctggcaaagcactcgacaccaaccgctactgcatcctatgcaccaac
gtgctcggaggatgcaaaggatccaccggaccgagcagtccacacccagacggaaaacca
tggggatccagatttccagccctttcaatccgtgaccttgtcaatgccgaaaaacaactt
ttcgaccacctcggcatcaataaaattcacgcaatcatcggcggatccatgggaggcgca
cgcaccctcgaatgggctgcactccacccacacatgatgacgactggattcgtcatagca
gtctcagcacgcgcaagcgcttggcaaatcggtattcaaactgcacaaatcagcgccata
gaactcgacccccactggaacggcggcgattactacagcggtcacgcaccatgggaagga
atcgccgccgctcgccggatcgcccacctcacctatcgcggcgaactagaaatagacgaa
cgattcggcacttccgcacaacacggtgaaaacccactcggccccttccgagatccacat
caacgttttgcggtcacgagctacctccaacaccaaggcatcaaactcgctcaacgattc
gatgcaggtagttacgtcgtgcttaccgaagccctcaatcgtcatgacatcggacgcggc
cgaggcggactcaacaaagccctcagcgcaatcacagtccccatcatgattgctggcgtt
gataccgatattctctacccctatcaccagcaagaacacctatcacgaaatctaggcaac
ctactcgctatggcaaaaatcagctcaccagtaggccacgacgctttcctcacagaattc
cgacaaatggagcgaatcctaagacatttcatggagctttcggaaggaatcgacgattcc
ttccgaaccaaactagagcgctga

DBGET integrated database retrieval system