KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0627Help
Entry
DIP0627           CDS       T00151                                 

Gene name
hmuU
Definition
(GenBank) Iron-related transport system membrane protein
  KO
K02015  iron complex transport system permease protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi02010  ABC transporters
Module
cdi_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DIP0627 (hmuU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdi02000]
    DIP0627 (hmuU)
Transporters [BR:cdi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    DIP0627 (hmuU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: CAE49144
UniProt: Q6NIY9
Position
595775..596827
Genome map
AA seq 350 aa AA seqDB search
MTHRYSKRSDDVFVLRARRRVMLFVVLVVLVLASVITSLALGQYYVPLRDLLTILTQPDS
SSLMHNVIWEIRLPRIVLGLLVGACLGVAGTLMQAVFANPLAEPSIIGVTSGAGVGAAAV
IVFNVGILGTFTVPAAAFLSAVVVTVIIYQLARHQGKVAIVNLILTGIAINAVCNALISF
LVYLAPTSNREEIVFWQMGSLNGAQWKHVWVVAPIALVGIVISSQIGKQLDVLALGERAA
GHTGINVGRLRIIAIAASTILTAAAVSFAGLIGFVGLIVPHLLRSISGPENRLLLPASAL
AGAVLIACADVAARTMIPFADLPIGIFTALVGGPTFFVLLRRMLKKGSVH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacccacaggtatagcaagcgtagcgacgacgtgttcgttcttcgggcacgtcgtcga
gtgatgttgtttgttgtcttagtggtgttggtgttggcgtcagttattacgtcgttggcg
ttggggcagtactatgttccgcttcgcgacttattgacgattcttactcagcctgattca
agcagtttgatgcacaacgttatttgggagatccgtcttcctcgaattgtgttgggtttg
ttggttggtgcatgccttggtgtggctggcactctgatgcaagccgtttttgcgaatccg
cttgcggagccgtcgattatcggagttacttctggagccggtgtgggtgcagcagcggtg
atcgtattcaacgtgggaattttgggtacttttactgttcctgcggcagcatttttgagt
gcggttgttgtgacggtgattatctatcagctggctcgacatcaaggtaaggttgcgatc
gtcaatttaattttgactggtattgccatcaatgccgtgtgtaatgcattgatttctttt
cttgtgtaccttgctcctacgtcgaatcgtgaagagattgttttttggcagatgggatcg
cttaatggagcacagtggaaacacgtctgggtagttgcccctattgcactggtaggaatc
gtcatttcttcccaaatcggtaaacaactagatgtgctagctcttggcgaacgcgcggca
gggcacacgggtatcaatgttggacgattgcgcattattgctattgctgcctcgacgatt
ttgactgcagcggctgtgtcgtttgctggattgattggttttgttggtttgattgttcct
cacttgctgcggagtatttctggcccagagaatcgtctactccttccagcatctgcgttg
gcaggagcggtattgatcgcgtgcgcggatgttgctgcgcgtacgatgattccgtttgcg
gatttgccgattggtatctttacggcacttgttggtggcccaacattttttgttttgtta
cgtcgaatgttgaagaaaggctctgtccattga

DBGET integrated database retrieval system