KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0631Help
Entry
DIP0631           CDS       T00151                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00020  Citrate cycle (TCA cycle)
cdi00480  Glutathione metabolism
cdi01100  Metabolic pathways
cdi01110  Biosynthesis of secondary metabolites
cdi01120  Microbial metabolism in diverse environments
cdi01130  Biosynthesis of antibiotics
cdi01200  Carbon metabolism
cdi01210  2-Oxocarboxylic acid metabolism
cdi01230  Biosynthesis of amino acids
Module
cdi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DIP0631 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DIP0631 (icd)
Enzymes [BR:cdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DIP0631 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CAMP_factor
Motif
Other DBs
NCBI-ProteinID: CAE49148
UniProt: Q6NIY5
Position
complement(600526..602739)
Genome map
AA seq 737 aa AA seqDB search
MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGRILAQFPDYLNEDQKV
DDALAELGELAKTPEANIIKLPNISASVPQLKAAIAELKAQGFALPEYPDSPATDEEKDV
RARYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKNPHKMGVWSADSKTNVATMDANDFR
HNEKSVIMPAADTLTIKHIATDGTETILKDGLKVLEGEVIDGTFLSAKALDAFLTEQVQR
AKNENVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFATYGDQLNAAGLNGENGLAAIYS
GLDALDNGAEIKAAFDAALEAGADVAMVNSAKGITNLHVPSDVIIDASMPAMIRTAGHMW
NKDDQEQDTLAVIPDSSYAGVYQVVIEDCKKNGAFDPTTMGTVPNVGLMAQKAEEYGSHD
KTFKIAADGKVVVVNAAGEALIEHDVEAGDIWRACQAKDAPIQDWVKLAVTRSRLSGMPA
VFWLDPKRAHDRSLITLVKKYLADHDTEGLDIQIMSPTEATQFSIDRIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEENHLRWDSL
GEFLALAESLRHFANTEGNTKAGVLADALDRATETLLNEGYSPSRKAGEIDNRGSHFFLT
LNWAKELAAQTDDTALAETFAPVAAQLEDNKDTIAAALIDVQGTPVDLGGYYQPDDAKTA
AVMRPVAEFNDIIDALK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcatttacacccgcaccgacgaagcaccgttgcttgctacgtactccctg
aagccagtcgtcgaagccttcgcttccaccgccggcatcgaggttgaaactcgcgatatt
tccctcgcgggccgtattcttgcccagttccctgactatctcaacgaggatcagaaggtc
gacgacgcacttgcagagctcggcgagctggccaagaccccagaagcaaacatcattaag
cttcctaatatttcggcatccgtgccacagctcaaagcagccattgcagagctcaaagca
cagggcttcgcacttccggagtacccagactcccccgccaccgatgaagaaaaagacgtc
cgtgcgcgctacgatgccgtcaagggctctgccgtcaacccagtacttcgtgagggcaac
tccgaccgccgcgcccccatcgcggtgaagaacttcgccaagaagaacccccacaagatg
ggcgtttggtccgctgactccaagaccaacgtagccaccatggacgcaaacgacttccgc
cacaacgagaagtccgtcatcatgcctgctgcagacaccctcaccatcaagcacatcgcc
accgacggcaccgaaaccatcctcaaagatggcctcaaggttctcgaaggtgaagtcatc
gacggcaccttcctgtccgccaaggctctcgacgccttcctcaccgagcaggtacagcgt
gccaagaatgagaacgttttgttctccgcccacctcaaggcaaccatgatgaaggtatcc
gaccccatcatcttcggacacgtcgtccgcgcctactttgccgacgtctttgccacctac
ggtgaccagctcaacgcagccggcctcaacggcgaaaacggccttgccgcaatctacagc
ggcctcgacgccctcgacaatggcgccgagatcaaggcagctttcgacgccgctctcgaa
gcaggtgccgacgttgccatggtcaactccgccaagggaatcaccaacctccatgtccct
tccgatgtgatcatcgacgcctccatgccagccatgatccgcaccgcaggccacatgtgg
aacaaggacgatcaggaacaagataccctagcagttatcccagactcctcctacgcaggc
gtctaccaagtcgtcattgaagactgcaagaagaacggcgccttcgatcccaccaccatg
ggcaccgtgcccaacgtcggactcatggcacaaaaagccgaagagtacggctcccacgat
aagaccttcaagattgcagcagacggtaaggtagtcgtcgtcaatgccgcaggcgaagca
ctcatcgagcacgacgtagaagcaggcgacatctggcgcgcatgccaggccaaggatgcc
ccaatccaagactgggtcaagctcgccgtcacccgctcccgactctccggcatgccagca
gtattctggctcgacccaaagcgtgcccacgaccgcagcctgatcaccctagtaaagaag
tacctcgctgatcacgacaccgagggcctcgacatccagatcatgagccccaccgaggca
actcagttctccatcgatcgcatccgccgcggcgaagacaccatctccgtcaccggcaac
gtgctgcgcgactacaacaccgacctattcccaatcctcgagctcggcacctccgccaag
atgctctccgtcgtgccactcatggcaggcggcggactcttcgaaactggcgccggcgga
tctgcaccaaagcacgtccaacagctcgttgaagaaaaccacctgcgctgggactccctc
ggcgaattcctcgccctagcagaatccctgcgccacttcgccaacaccgaaggcaacacc
aaggcaggcgtacttgccgacgccctcgatcgagcaaccgaaaccctcctcaacgagggc
tactccccatcgcgcaaagctggcgaaatcgacaaccgtggctcgcacttcttcctcacc
ctcaactgggccaaggaactagcagcccaaaccgacgacaccgcgctagccgaaaccttc
gcacctgtcgccgcacagctcgaggacaacaaagacaccatcgcagcagcgcttatcgac
gtccaaggcacaccagtagacctcggcggctactaccagcctgacgacgccaagaccgca
gcagtcatgcgccccgtcgcagaattcaatgacatcatcgatgcgctgaagtaa

DBGET integrated database retrieval system