KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0633Help
Entry
DIP0633           CDS       T00151                                 

Definition
(GenBank) Putative exodeoxyribonuclease
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DIP0633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cdi03400]
    DIP0633
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     DIP0633
DNA repair and recombination proteins [BR:cdi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     DIP0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: CAE49150
UniProt: Q6NIY3
Position
604219..605124
Genome map
AA seq 301 aa AA seqDB search
MQITTVNVNGIRAAVKQRSDANRGMLPWLEQCGSDVVLLQEVRASEKDSLTALAPALDAG
WHYVGAPAAAKGRAGVGILSRQPLRDVQVGLEGFVDSGRYIQATLSDPDTGHDVVVASLY
LPSGSADTDKQDEKYRFLDVFGPFLEQAAQDNPHMVVGGDWNICHRMQDLKNWKTNRKKS
GFLPDERAFMDSVFGVFPDSESQVSDAGQWAGAVDYTSQQRRTPANDPKWFDVARRLAPE
DAAYTWWTYRGQAFDTNAGWRIDYQAATSAMLERATRCWVDKAAAYDLRWSDHSPLTVVY
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattacaacagttaacgtcaatggaattcgtgctgccgtcaagcagcgtagcgac
gccaaccgcggaatgcttccgtggctagagcagtgtggctccgatgtcgtgttgctgcaa
gaggttcgtgcttcggaaaaagattctcttactgctttggcacctgccctcgatgccgga
tggcactatgttggcgctcctgctgctgccaaaggccgcgccggggtgggtattttaagt
cgccagccactgcgtgatgttcaggtggggttggaaggattcgtcgattctggccggtac
atccaagcaacactgtctgatcctgatacaggtcatgacgtggtggtggcgtcgctctac
ttgccttctggttctgccgacactgataagcaagacgagaaataccgtttccttgatgtg
ttcggtccgtttcttgagcaggcagcgcaggataatccgcacatggtggtcggtggcgat
tggaacatttgtcaccgcatgcaagatctgaagaattggaaaacaaaccgaaagaagtct
ggattccttccagacgaacgggcttttatggattcggtatttggtgttttccctgattct
gaaagccaggtgtccgatgctggccaatgggcaggtgcggtggactacacctcgcagcag
cgtcgtactccggcgaacgacccgaaatggtttgacgtggcgcgtcgattagctcccgag
gatgctgcttatacttggtggacttatcgtggccaggcgtttgatacgaatgctggttgg
cgtattgattatcaagcagcaacttctgcgatgctggagcgtgcgactcggtgctgggtc
gataaggcagcagcatatgatttgcgctggtcggatcactcacctttgacggtggtgtat
tcctag

DBGET integrated database retrieval system