KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0646Help
Entry
DIP0646           CDS       T00151                                 

Gene name
pyc
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00020  Citrate cycle (TCA cycle)
cdi00620  Pyruvate metabolism
cdi01100  Metabolic pathways
cdi01120  Microbial metabolism in diverse environments
cdi01200  Carbon metabolism
cdi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cdi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DIP0646 (pyc)
   00620 Pyruvate metabolism
    DIP0646 (pyc)
Enzymes [BR:cdi01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     DIP0646 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAE49163
UniProt: Q6NIX0
Position
617693..621118
Genome map
AA seq 1141 aa AA seqDB search
MSQQSSERGTSTVNPLSKILVANRGEIAVRAFRAAFETGAATVAVYPNEDRNSFHRSFAS
EAVLIGEGGSAVKAYLDIDEIIRAAKQTGADAIYPGYGFLSENAQLARECAENGITFIGP
PPSVLELTGDKAAAVTAAREAGLPTLTETEATDDPKKLAELTKGQTYPLFVKAVAGGGGR
GMRFVDAPENLEKLAAEASREAAAAFGDGRVYAERAVINPQHIEVQILGDSAGNIIHLYE
RDCSLQRRHQKVVEIAPAQHLAPGLREKICADAVAFARHIGYQGAGTVEFLVDEEGNHVF
IEMNPRIQVEHTVTEEVTQVDLVKSQIMIASGATLEDLGLRQEDIHTEGAALQCRITTED
PNNGFRPDTGTITAYRSPGGAGVRLDGAAMLGGEITPNFDSMLVKMTCRGADFATAVARA
QRALAEFVVSGVATNIGFLRALLREEDFQHKRIATGFIADHPWLLQAPPADDEPGRILNY
LADVTVNKPHGLRPAVINPVEKLPAEIKGELPRGSRDRLLQLGPEGFARALRKQDALAVT
DTTFRDAHQSLLATRVRSNTLIDAARHVAKLTPELLSVEAWGGATYDVAMRFLHEDPWER
LDHLREAMPNVNIQMLLRGRNTVGYTPYPDSVCKAFVDEAARSGVDIFRIFDALNDVSQM
RPAIDAVLETNTTIAEVAMAYSGDLTNPSEKLYTLDYYLKLAEEIVKSGAHVLAIKDMAG
LMKPAAATKLVTELRRNFDLPVHVHTHDTAGGQLATYWAAAAAGADAVDGASAPLSGTTS
QPSLSAIVAAFANTYRDTGLSLDAVGSMEPYWEAVRKLYAPFESGTPGPTGRVYQHEIPG
GQLSNLRAQATALGLADRFELIEDYYAAVNEMLGRPTKVTPSSKVVGDLALYLVGAGVNP
ADFAADPQKYDIPDSVIAFLRGELGTPPGGWPEELRAKALAGRKESKDTLAPLPAEDEAL
LADRATVRPTLDRLLFPKPAAEFAEHRRQFGDTTKLGDAEFLYGLKEGKETVIRTADSSV
PMLVRLDAVGEPDEKGMRNVVCNVNGQIRPILVRDRSVESVTASVEKADPSNAGHVAAPF
AGVVTVTIEEGATVKAGDPVAVIEAMKMEATISATTDGTVDRIVLTQATKVEGGDLLLVI
K
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcaacaatcatctgaacgtggaacctctacggtaaatccattgtcaaagatcctc
gttgctaaccgtggcgagatcgccgtgcgagcttttcgtgcagcctttgaaaccggtgct
gccacggtagctgtctacccgaacgaagaccgtaattcattccaccgatcgtttgcctct
gaagctgtcctcattggtgagggcggatctgcggtcaaagcgtacctcgatatcgacgaa
atcatccgtgctgctaaacaaacgggtgccgacgcaatttacccaggctacggcttcctt
tccgaaaacgcccagcttgctcgtgagtgcgctgaaaacggcataacctttatcggtcca
cctccatcagtgctggagcttaccggtgataaagcagctgctgttaccgcagcacgcgag
gcaggtttgcccacgctgactgagacagaagcaacagacgatccaaagaagctcgcagag
ctgaccaaggggcagacctacccgctattcgtcaaagccgttgccggtggtggtggccgc
ggcatgcgttttgtcgacgcccccgaaaacctagaaaagctagcagcagaagcctcccgt
gaggcggctgcagcattcggcgatggccgagtctacgccgagcgtgcagtaatcaatcct
cagcatattgaggtccagatccttggtgactccgctggcaacatcatccacctgtacgag
cgtgattgctcgctgcagcgtcgccaccaaaaggtcgtagagatcgccccagcacagcac
ttggcgcccggactacgcgaaaagatttgtgcagacgcagtcgcgtttgcacgccacatc
ggttaccaaggtgcaggcacggtcgagttcctagtcgatgaggaaggcaaccacgtcttc
atcgagatgaaccctcgtatccaggtcgaacacaccgtgaccgaagaggtcacccaagtc
gacttggtgaagtcccagatcatgatcgcctccggtgcgacactcgaagatctcggtctg
cgccaagaagacatccacaccgaaggcgctgccctgcagtgccgtattactactgaagac
cccaacaacggtttccgtcctgacaccggaacgattaccgcttatcgttccccaggtggc
gcaggtgttcgtctcgacggtgctgccatgctcggtggtgagatcaccccgaatttcgac
tccatgctggtcaagatgacctgccgtggtgccgatttcgccaccgcagtcgctcgcgct
cagcgtgcactcgcagaattcgttgtctcaggtgttgctaccaacatcggattcctgcgt
gctttgctacgcgaagaagacttccagcacaagcgcatcgccactggcttcatcgcagat
cacccatggctgctgcaggcaccacctgccgacgatgagcctggccgcattttgaactac
ctagctgatgtgactgtgaacaagcctcatggtctacgcccagccgtgatcaacccggta
gaaaagctcccagcagagatcaaaggtgagctaccacgtggttcccgtgatcgcctgctc
cagctcggcccagagggatttgcgcgcgcactgcgtaaacaggatgcgctcgcggttacg
gataccaccttccgtgatgcacatcagtcgcttctcgcaacccgcgtgcgctccaacacg
ctgatcgacgcagcacggcacgtcgcaaagctcaccccagagctgctctctgtagaagca
tggggtggtgctacctatgacgttgctatgcgcttcctacatgaggacccctgggagcgt
ctcgaccacctgcgtgaggccatgcccaacgtcaacattcagatgctgctgcgaggccgc
aacacagtcggctacacaccgtacccagattctgtatgcaaggcttttgtcgacgaagcc
gcacgctctggtgttgatatcttccgcatcttcgacgcgcttaacgacgtctcccagatg
cgtccagcaatcgacgcagtgctcgaaaccaacaccacgattgccgaagtcgcaatggcc
tactccggtgatctgaccaacccaagtgagaagctctacacactggattactaccttaag
cttgccgaggaaatcgttaagtccggtgcacatgttctagccattaaagacatggctgga
ctgatgaagccagccgcagcaaccaagctggtcaccgaactacgacgcaacttcgacctg
ccggttcatgttcacacccacgacactgctggtggccagctggctacgtattgggctgca
gcagccgctggtgcagatgccgtcgatggtgcctccgcgccactgtcgggcacaacgtcg
cagccatcgttgtctgcaattgtggcagcattcgctaacacctaccgcgatacgggtctc
tctctggacgcagtcggatcgatggaaccgtactgggaagcagtgcgcaaactctacgca
cccttcgaatccggaaccccaggaccaactggccgcgtctaccagcacgaaatcccaggc
ggccagctgtccaatctgcgcgcacaggcaactgcactcggcttggcagatcgcttcgag
ctcatcgaggactactacgcagccgttaatgagatgctgggacgccccaccaaggtcacc
ccgtcctcaaaggtcgttggcgatcttgcactctacctagtcggcgcaggagttaaccca
gcggactttgcagcagatccccaaaagtacgatattcctgactccgtcattgccttcctc
cgtggtgagctcggcacccctccaggcggctggccagaagaactgcgtgctaaggcattg
gcaggacgtaaggaatcaaaggacacattggccccgctgccagcagaagatgaagctctg
ctcgcagatcgtgcgaccgttcgcccaacgctggatcgcctgctcttcccgaagcctgcg
gcagaattcgcagagcaccgccgtcagtttggcgataccaccaaactcggtgacgcagaa
ttcctctatggcctcaaagaaggcaaagaaacggtcattcgtaccgcagacagtagcgtc
ccaatgctggtgcgtctcgatgccgtcggcgagcccgacgaaaagggcatgcgcaacgtt
gtgtgcaatgtcaacggccagattcgccccatcctcgtgcgtgatcgcagcgtagagtca
gtgaccgcctcggtggaaaaggctgatccttccaacgccggacacgtagcagcaccattc
gcaggcgttgtcacagtgacaatcgaggaaggcgctaccgtcaaagccggcgatccagtt
gctgtcattgaggcaatgaagatggaggcaacgatctctgccaccacagacggaaccgtc
gaccgtatcgtcttgacgcaggccaccaaggtcgaaggtggagacttgctcctcgtgatc
aagtag

DBGET integrated database retrieval system