KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0650Help
Entry
DIP0650           CDS       T00151                                 

Gene name
sseA
Definition
(GenBank) Putative thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00270  Cysteine and methionine metabolism
cdi00920  Sulfur metabolism
cdi01100  Metabolic pathways
cdi01120  Microbial metabolism in diverse environments
cdi04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DIP0650 (sseA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DIP0650 (sseA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    DIP0650 (sseA)
Enzymes [BR:cdi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     DIP0650 (sseA)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     DIP0650 (sseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: CAE49167
UniProt: Q6NIW6
Position
complement(624604..625485)
Genome map
AA seq 293 aa AA seqDB search
MPAPFDPHPQFQEYAHPEKLVSASWLSARLGTKGLRVVESDEDSLLYDIGHIPGAVRIDW
AKDLNDATIRDYISAKDFAALMDAKGIARDDTVVIYGDKSNWWATFTLWIFELFGHEDVR
ILNGGRDAWMAEERDTSYAVPEYPATGYPVVTDTSAPARIFVDELVSKLGTQQLIDVRSE
SEYAGTTDNDYPSSGVLRSGHIPTAVNIPWNKSVHPNSRFRSFSELSEIYGGLDKNAETV
TYCQVGDRAAHTWFVLKYLLGHDIARTYDGSWAEWGNMIRMPIAKGEEPGVAP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaccattcgatccacacccacagttccaggagtacgcacaccccgaaaagctc
gtctccgcctcgtggctgagcgctcgcctaggcactaaaggccttcgcgttgtggaatcc
gacgaggactcactcctctacgacatcggacacatccccggtgccgtacgcatcgactgg
gccaaagaccttaacgacgccaccatccgcgattacatcagcgccaaggatttcgcagcg
ctcatggacgctaaaggcatcgcccgagacgacaccgtagtgatctacggcgataagtcc
aactggtgggcaacctttaccctatggatcttcgagctcttcggccatgaggatgtccgt
atcctcaacggtggccgagacgcatggatggccgaagaacgcgacacctcgtatgccgtt
ccggagtaccccgcaaccggctaccccgttgtcaccgataccagcgcaccagcgcgcatt
tttgtcgacgagctcgtgagcaaactgggcacgcaacagcttatcgacgtccgcagtgaa
tccgaatatgcgggcaccacagacaatgattacccctcatctggggtgttacggagcggc
catatcccaaccgcagtgaacattccatggaataagtcagtacacccgaacagccggttc
cgctccttttccgaactcagtgagatctacggtggactcgacaaaaatgccgaaaccgtc
acctactgtcaagtaggcgaccgcgcagcacacacttggttcgtcctaaagtacctgctt
ggacacgacattgcccgcacttacgacggatcttgggccgaatggggcaacatgattcgc
atgcctatcgcgaaaggcgaagagcccggcgtggcaccctag

DBGET integrated database retrieval system