KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0656Help
Entry
DIP0656           CDS       T00151                                 

Definition
(GenBank) Putative transcriptional regulatory protein
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 Peripla_BP_3 Peripla_BP_4 LacI HTH_IclR HTH_24 HTH_Tnp_ISL3 MarR_2 HTH_23 HTH_31 HTH_40 HTH_35 Sigma70_r4_2 HTH_Crp_2 HTH_3 HTH_36 Sigma70_r4 HTH_38
Motif
Other DBs
NCBI-ProteinID: CAE49173
UniProt: Q6NIW0
Position
complement(631544..632599)
Genome map
AA seq 351 aa AA seqDB search
MSDISQPTVENEEKSPTWRRRRQSITLKDIAADTGLSISTVSRALARNPVIPESTRSIVE
EAAGRLNYRPNAQAKALRSQKSNTIGIVLPNIRNPYFNQLASAIQEAASLKGYCCMMANS
AESPELINSALDILNSQQVDGIIVVPHIQSAQQITAITEQGTPIVAADRTVTHSAVPSVT
SDPLPAMKEALRMLSLNPGASIGYLAGPQDTSTGRERLEAITSIKSELGIPSPDVYFGGY
SSEAGFAGTHELLDRGVNSILTGDMMMTVGAIQAIYARGLRIGKDVALIGYDNTPAFLLQ
EQPITTIDQQVDDMGQRAFDMLYSHMNNGERATSCVIPTTLALRASHSLAV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatctctcaaccaacagttgagaacgaagagaaatcacctacatggcgcaga
cggcgacaaagcatcacgctgaaagacattgccgccgacactggcttgtctatcagcacc
gtgtcgcgagcactggcccgcaaccccgttatccccgaatcaacccgtagcatcgtcgaa
gaagcagctggaagactcaactaccggcccaatgctcaggcaaaggcgctccgcagccaa
aagtccaataccattggcattgtcttgccaaatatccgcaacccttacttcaaccagcta
gcatcagctattcaagaagccgcaagccttaagggctactgctgcatgatggcaaattcg
gcagaatcgcccgagcttattaacagtgctttggatattctcaacagccagcaggttgac
ggcatcatcgtagtcccccacattcagtcagctcaacaaatcactgccattacagaacaa
ggcacacccatcgttgcggctgaccgaacagtcacccacagtgccgttccgtctgtcacc
tctgatccactgccagcgatgaaagaggctctgcgaatgctaagcctgaacccaggggcg
tcgataggataccttgccgggccacaagatacgtcgacaggcagggagcgcctcgaagcg
atcacgtcaatcaagagcgaactgggaattccttcccctgacgtttattttggcggctac
tccagcgaggccggttttgcgggcacacacgagctccttgaccgcggagtcaatagcatt
ttgaccggcgatatgatgatgacggtcggcgcgattcaggcgatctacgcccgtggactt
cgcatcggtaaggatgtggcgttgatcggctacgacaacaccccagcgttccttctccaa
gaacaacctatcaccaccatcgatcaacaagtcgatgacatgggacagcgcgcattcgac
atgctttactcacatatgaataacggcgaacgagcaacgtcatgcgtcatcccgacaacg
cttgcgctgcgggcttcccattcgttggcggtgtag

DBGET integrated database retrieval system