KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0667Help
Entry
DIP0667           CDS       T00151                                 

Gene name
hypC
Definition
(GenBank) hydrogenase expression/formation protein HypC
  KO
K04653  hydrogenase expression/formation protein HypC
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    DIP0667 (hypC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HupF_HypC Prot_ATP_ID_OB
Motif
Other DBs
NCBI-ProteinID: CAE49184
UniProt: Q6NIU9
Position
complement(643324..643581)
Genome map
AA seq 85 aa AA seqDB search
MCLGVPAQIAEIHDSTRATVSMSGVSRMVSTDLLAETIDVGDWVLIHVGFALSKIDEDEA
AVTLQQIKQLGGFDEELQSFESSEI
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgtgccttggggtgcccgcccaaattgcggaaattcatgactctacgagagctactgta
agcatgagtggcgtctcgcgcatggtttccaccgatcttcttgccgaaacaattgatgta
ggtgactgggttttgatccatgtgggttttgcgctgagcaagattgatgaagacgaggcg
gcagtgacgcttcaacaaattaagcagctgggcggctttgatgaggaactgcaatctttt
gagtcatcggagatttga

DBGET integrated database retrieval system