KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0669Help
Entry
DIP0669           CDS       T00151                                 

Definition
(GenBank) Putative hydrogenase maturation protein
  KO
K04656  hydrogenase maturation protein HypF
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    DIP0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC zf-HYPF Acylphosphatase Peptidase_M22
Motif
Other DBs
NCBI-ProteinID: CAE49186
UniProt: Q6NIU7
Position
complement(644718..646952)
Genome map
AA seq 744 aa AA seqDB search
MLRTRYLLRGVVQGVGFRPHVAAVAARHRITGLCGNNDLEVFVEAQALSEDILDAFISDV
LATLPPLAHVVTVTQSSCPPISHETDFRIVASEHLPGARTLIPPDVATCPDCLADMADPN
NRRYRYPFTTCTHCGPRLSIIEDLPYDRPLTTMKHFPMCPQCAKEYSDPHDRRYHAQPIS
CPDCGPSLWVEATETPGRPPLRLRVDDPIAYCRDAISKGKIVAVKGLGGFHLMCDATNDE
AVRTLRERKHRPTKPLAVMIPDVEKARELARLDADTTAVLTDPAHPIVLVPTTSKQRLKL
SLLIAPGLDYVGLVLPYTPLHTLLVDSPVVATSANNSGEPLCWDNDVARENLTHLADVFL
MHDRPIHIPVEDSVVVPSAHGIVPIRRSRGFAPLPLTIPTFAEAGQPALSTLAVGGELKN
TFTLAHEDYAHISSHIGDMGSWPSQQAFHRAVDQMLSMQRTRPDLLVCDLHPSYATTAWA
QRYSESNDIPLVQVQHHEAHAMALLAEHRACGTPAVILAADGTGYGHDNTIWGGELLSYH
PDTGFERTWHVPTFELVGGDRAVQHPWRIAAGIAHAWGLDWDCGKESSILSHTSAAEIEL
VESQLSSGFGVVRTSSLGRVFDAAAAIVGIHPPSFEAESAMLFEAAARNCEKRESEATSF
PEAFAELLETRNPWTFHHAVAQILQHHIDEAAVGMSTGLTGGCALNQLLSSMLRVDMRHQ
IVPPNDGGLSLGQAVLGRWTVSTA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcactcgataccttctcaggggtgtagttcagggggtaggctttcgcccccac
gttgccgccgtcgccgcccgtcatcgcataactggcttgtgtggcaacaacgatcttgag
gtgtttgtcgaggcccaagccctatccgaggacatcctcgatgcattcatttccgacgtg
ctcgccaccctcccaccactcgcacacgtggtaaccgtcacgcagtcatcatgcccaccg
atcagccacgaaacagacttccgcatcgtcgcatccgagcatctccccggcgcgcgcaca
ctgatcccacccgatgttgcgacctgccctgattgtttggcggatatggcggatccaaac
aatcgccgttatcgctacccttttacaacgtgtactcattgtggaccgcgtttgagcatc
attgaggaccttccctatgaccgaccgctaacaacaatgaagcatttccccatgtgcccg
cagtgcgccaaggagtattccgatccgcacgatcgccgctatcatgcccagccaattagc
tgccctgattgcggtccgtcgttgtgggtagaggctactgaaacgcctggcaggccaccg
ctacgcttgcgtgtcgacgaccccatcgcttactgccgtgacgcgatctcgaagggaaag
attgtagccgttaagggcctaggcggattccatctcatgtgcgacgcaaccaatgacgaa
gcagtgcgaacgctgcgcgaacgtaagcatcgccccacaaaaccgctggccgttatgatt
cccgatgtggaaaaagcccgtgagctagccagattagatgccgataccacggcggtgctt
actgatcccgcgcatcccatcgttttagtgcccacgacaagcaagcaacgcctcaaactc
agcctactcattgctccaggcttggactatgtaggactcgtgctgccctatacaccactg
catacgctcttggttgactcccctgtcgtagcgacttctgccaataactccggcgagccc
ctgtgctgggataatgacgtagcgcgcgagaatctgacgcatcttgccgatgtgttcctc
atgcacgatcgcccgattcatattcctgtggaagattcggtggtcgttcccagcgcacac
ggcattgttcccattagacgatcgcgggggtttgccccactgccactgacgattcccact
tttgccgaagctggccaaccggcactgagcacgctcgcagtcggtggagaactaaaaaac
acttttacccttgctcacgaagactacgcacatatctctagccacattggggatatggga
tcgtggccaagccagcaggcgtttcatcgcgcagttgatcaaatgctgagcatgcagcgc
acccgccccgacttgttggtctgcgatcttcatcccagctatgccaccaccgcttgggca
cagcgctatagcgaatccaacgatattccgcttgttcaggttcagcatcatgaagcccat
gcgatggcgcttcttgctgaacaccgcgcatgtggtacaccagcggtcattctggccgca
gacggcaccggctatgggcacgacaatacgatctggggtggcgagcttctttcctatcat
cctgatactggattcgagcgcacgtggcacgtccccacctttgaacttgttggtggcgat
cgcgcggtccagcatccgtggcggatcgcagcaggcatcgcgcatgcgtggggtctggac
tgggattgtgggaaagaatcgtcgattctttcccacacatctgcggcagagatcgaacta
gtagaaagtcagttgtcgtctggctttggcgtggtgcgtacaagttcgctgggccgtgtg
tttgatgctgcggctgcaatcgtggggattcacccgccgagttttgaggcggagtcagcg
atgttgttcgaggctgcggctagaaattgcgagaaacgagaatcagaggcgacgtcgttt
ccggaggcatttgcggaacttcttgagactcgaaacccgtggacgtttcatcatgcggta
gcgcagattcttcagcaccacatcgatgaggctgcagtcggcatgagtaccggtcttact
ggtggttgcgcattgaatcaactgttgtcgagcatgttgcgcgttgatatgcgccatcaa
attgtgccgccgaatgatggcgggttaagcctcggccaggcggtgctgggacgttggact
gtgagcaccgcctag

DBGET integrated database retrieval system