KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0740Help
Entry
DIP0740           CDS       T00151                                 

Gene name
mmdA
Definition
(GenBank) methylmalonyl-CoA decarboxylase, alpha-subunit
  KO
K17489  methylmalonyl-CoA carboxyltransferase 12S subunit [EC:2.1.3.1]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DIP0740 (mmdA)
Enzymes [BR:cdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     DIP0740 (mmdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE DUF1844
Motif
Other DBs
NCBI-ProteinID: CAE49262
UniProt: Q6NIM8
Position
716559..718115
Genome map
AA seq 518 aa AA seqDB search
MAKELSMAERLEKLAAAKAEVSLGGGQAKIDKQHEKGKLTARERIDALVDDGTFFETGMF
AKHRTTHFGMDKANAPADGVVTGSGAVFGRPVHIASQDFTVMGGSAGETQSNKVAAMMEA
SATTGTPFIFINDSGGARVQEGIDSLSGYGKVFYQNVLLSGLVPQVSIIAGPCAGGAAYS
PALTDFIIQTRKANMFITGPGVIKSVTGEEVTSDALGGADAHMTKAGNIHFIADDDEQAV
LIAQKLLSFLPQNNTEEPPVVDPDPVVEPDPELRDIVPVEGKKGYDVRDIISRVVDRGDF
LEVQAGYATNIVVGFARIVGRTVGIIANQPNVMSGVLDINSSDKGSQFIRFCNAFNIPLV
TFVDVPGFMPGVAQEHGGIIRHGAKMLYAYSAASVPKVTIELRKSYGGAHLAMCSKDLGA
DRVFAWPTAEIAVMGAEGAVNVVFRKEIEAAEDKDAKREELIQLYKDTFSTPFMAASRGL
VDDIIDPAETRLHIANALEVLTNKRVTRPAKKHGLGPV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaattgtcgatggccgagcgcctcgaaaagctggcagctgctaaggccgag
gtaagccttggcggtggtcaagccaagattgataagcagcacgaaaagggcaagcttact
gctcgcgagcgtatcgacgcgcttgtcgacgacggcaccttctttgaaactggcatgttt
gctaagcatcgcaccactcactttggtatggacaaggcgaatgccccagcagatggtgtt
gtgactggttccggagctgtgttcggtcgccctgtccacatcgcttctcaagacttcacc
gtcatgggtggttctgcaggtgagacgcagtccaacaaggtcgctgcgatgatggaggct
tcggccaccaccggtacgccgttcatcttcattaatgactccggcggagctcgtgtccag
gagggtatcgactccctgtccggttacggcaaggtgttctaccaaaacgtgctgctatcg
ggtctggtcccacaggtctcgatcatcgctggcccttgtgccggtggtgcagcatactcg
ccagcgctgactgacttcatcatccagacccgcaaggccaacatgttcattactggcccc
ggtgtgatcaagtccgttactggcgaagaagtcacctctgatgcacttggtggtgcagac
gcacacatgaccaaggccggcaacatccacttcattgctgatgacgacgagcaagccgtc
ctgatcgctcagaagctgctgagcttcctgcctcagaacaacactgaggagccacctgtg
gtggatcctgacccagtagttgagcctgatccagagctgcgtgacattgttcctgtggaa
ggcaagaagggctacgatgtccgcgacatcatcagccgtgtagtcgaccgcggtgacttc
ctcgaggtccaggcaggctacgctacaaacatcgtggttggttttgcacgtatcgtcggc
cgtactgtcggtatcatcgctaaccagccaaacgtgatgtcgggtgtcctagacatcaac
tcttctgacaagggcagccagttcatccgtttctgcaacgctttcaacattccactcgtt
accttcgtggacgttccaggctttatgccaggtgttgctcaagagcacggcggtatcatc
cgtcacggtgcaaagatgctttacgcatactccgcagcatcggtaccaaaggtgaccatc
gagctgcgtaagtcctacggtggcgctcacttggcaatgtgctccaaggaccttggtgca
gaccgtgtcttcgcatggccaactgctgagatcgctgtgatgggtgcagaaggtgccgtc
aacgtggttttccgtaaggaaattgaggctgccgaagacaaggacgcaaagcgcgaagag
cttatccagctgtacaaggatacgttctccacaccatttatggccgcatcccgtggtttg
gtggacgacatcatcgatccagcagagactcgcctgcacatcgccaatgcacttgaggtt
ctgaccaacaagcgcgttacccgccctgctaagaagcacggcttgggaccagtgtaa

DBGET integrated database retrieval system