KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0927Help
Entry
DIP0927           CDS       T00151                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DIP0927
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     DIP0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: CAE49446
UniProt: Q6NI51
Position
899713..900600
Genome map
AA seq 295 aa AA seqDB search
MSSLSSPARLLAIHAHPDDESSKGAATMAKYVAEGHEVMVVTCTGGELGDVLNPSLDKTA
VEGRIAEVRREEMAQAVKELGVQHRWLGYHDSGFPEGEPHPPVPPGSFALEDSDEVAAKI
VEIIREFRPHVIVTYDENGGYPHPDHLKVHEVSMLAWDLAGDPDYRLDLGQPWAPLKLYY
THGFIRQRMEMFHNLLVEQGKPSPYEGILDRWLEHRADIMARVTTQVYAADYFDRRDAAL
KAHATQIDPAGTFFATPIETQQQLWPTEEFELARTRVSTSLPEDDLFEGIDISAD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagctcactttcgtctccggcacgtttgcttgctattcatgcccacccagacgatgaa
tcaagtaagggtgcagccacgatggcgaaatatgtggctgaggggcatgaggtcatggtg
gtgacctgcaccggcggtgaacttggtgatgtgcttaatccgtcgcttgataaaactgcg
gtggagggcaggattgccgaggttcgtcgtgaagaaatggctcaagcagtcaaagaatta
ggagtccagcaccggtggttggggtatcacgattctggtttccccgagggggaaccgcat
ccaccggttccgccaggaagcttcgcactcgaagattctgatgaagtggcggcgaagatc
gtggagattattcgcgagtttcgcccgcacgtaatcgttacgtatgacgaaaacggcgga
tacccacacccggatcatctgaaagttcatgaggtatctatgctggcgtgggatctggcg
ggtgaccccgactatcgtcttgacctaggccagccgtgggctccgttgaagctttattac
acacatggttttattcgccaacgcatggagatgttccataatctgctggttgagcaaggg
aaaccgagtccttatgaggggattttagatcgttggcttgagcaccgtgcagacatcatg
gcacgagtaacaacgcaggtgtatgccgcagactattttgatcgtcgtgacgcggctctt
aaagctcacgccacgcaaattgatccggcaggcacattttttgctacaccgattgaaacc
caacaacaattgtggcctacagaagaatttgagctagctcgcacacgcgtttctacttcc
ttgccggaggatgatctttttgaaggaatcgatatctcggcagattaa

DBGET integrated database retrieval system