KEGG   Corynebacterium diphtheriae NCTC 13129: DIP0991Help
Entry
DIP0991           CDS       T00151                                 

Definition
(GenBank) Putative glycosyltransferase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00500  Starch and sucrose metabolism
cdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DIP0991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cdi01003]
    DIP0991
Enzymes [BR:cdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     DIP0991
Glycosyltransferases [BR:cdi01003]
 Polysaccharide
  Storage polysaccharide
   DIP0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: CAE49509
UniProt: Q6NHY9
Position
complement(960833..962005)
Genome map
AA seq 390 aa AA seqDB search
MRVAMMTKEYPPEIYGGAGVHVAELTRHMRDIVDVDVHCMGAPRNEDNVYTYGFDPELTS
ANAALQTMSTGLRMAHAAAYADVVHSHTWYTGLGGHLAGLLHEVPHIVTAHSLEPDRPWK
REQLGGGYDVSSWSEQNAMEYADVVIAVSAGMKDAILRAYPRIDADKIRVVLNGIDTQLW
QPRPTFDDAEHSVLRDLGIKPDQPIVAFVGRITRQKGVEHLVKAARYFSPGVQLVLCAGA
PDTPEIAARTQHLVEELQAEREGVVWVQEMLSKDKIQEILTAADAFVCPSIYEPLGIVNL
EAMACATAVVASDVGGIPEVVVDGTTGSLVHYDPNDTDTFEHDLAEAVNAMVTDRKRAAA
FGVAGRNRAVSEFSWGFIAQQTVDVYSSLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgcgatgatgaccaaagaatacccacctgagatctacggcggtgcaggagtt
cacgtcgccgagctcacccgccacatgcgcgacattgtcgatgtcgacgtccattgcatg
ggcgctccacgaaacgaagacaacgtctacacctatggctttgaccctgaactcacctcg
gccaacgccgccttacaaaccatgtccacaggactacgcatggcacacgccgcagcctac
gctgatgtagtccactcccacacgtggtacacgggactaggagggcatctagcggggctt
cttcacgaagtaccccacattgtcacagcccactcccttgaacccgaccgcccatggaag
cgggaacaacttggtggtggctacgatgtctcctcctggtcagaacaaaatgccatggaa
tacgccgacgttgtgatcgcagtgtcagccggaatgaaagacgctattctgcgcgcttac
ccgcgcatcgacgccgataaaatccgcgtcgtactcaacggcatcgacacacagctttgg
caaccacgccccacttttgacgacgccgaacactcagtactccgcgacctcgggatcaaa
ccagaccagcccatagtcgcctttgttggccgaatcacacgccaaaaaggcgtggaacac
ttagtcaaagccgctcgctacttcagcccaggagtccagctcgttttgtgcgccggagcc
cccgacaccccagaaattgcggcacgcacccaacacctcgtagaagaactacaagcagaa
cgcgaaggcgttgtttgggtacaagaaatgctgagcaaggacaagattcaagagatcctc
accgccgctgacgctttcgtctgcccctccatctacgaaccactcggaatcgtcaatctc
gaggccatggcatgcgccaccgccgttgtcgcctcagatgtgggcggaatccccgaggta
gtcgtcgacggcactaccggaagcctcgtccactacgaccccaacgacaccgataccttc
gaacacgacctcgccgaagccgtcaacgccatggtcaccgatcgaaaacgcgccgcagct
ttcggtgtagcaggacgcaaccgcgcagtatccgagttctcatggggcttcatcgcacaa
caaaccgtcgatgtgtactcctccctcctatag

DBGET integrated database retrieval system