KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1382Help
Entry
DIP1382           CDS       T00151                                 

Definition
(GenBank) Putative aminotransferase (biotin synthesis related protein)
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00780  Biotin metabolism
cdi01100  Metabolic pathways
Module
cdi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
cdi_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DIP1382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cdi01007]
    DIP1382
Enzymes [BR:cdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     DIP1382
Amino acid related enzymes [BR:cdi01007]
 Aminotransferase (transaminase)
  Class II
   DIP1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_5 SHMT Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAE49913
UniProt: Q6NGW8
Position
1399385..1400575
Genome map
AA seq 396 aa AA seqDB search
MSPSLDFYAHQRNVEWHERGLERTPAQFYSPQTPHAIIDNRPMLLFSSSDYLGLSEHPFL
KNAAIQAISSLGTGSGGSRLTTGSSIHRSIEIHLAQFFGSPDAVFFASGYQANVTIISTL
AGPHCTIYSDSLNHASIIDGCRLSKSQVKTFPTGDYEALDAALAHCDTTNSLIITDAVFS
MSGTIADLEQLRQVAARHGSWLLIDDAHGIGCLGNAGRGTAHLFPHAPTDFSQEVIVGTS
SKALGGEGGFALCSEQVATLLRNQGRGYVFSTAPAPATMATTDAALTVLEQEPDRIRRLQ
SNIAYFAQRSSNVVPFQKSGFFSPIISYTIGDENEALKSAQLLRDNGFFIPAIRYPTVSR
GSAMLRITMTAMHSHHDIDQLADALNQLESHRLDNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatcgcttgatttttatgctcaccaacgcaacgtggagtggcatgaacgagga
cttgagcgcacacccgcgcagttttattcacctcaaactccacacgcaataatcgataat
cgccctatgctgctattttccagctctgattatttaggccttagcgaacatcctttccta
aaaaacgccgcaatccaagcaatcagctctttaggtacaggatctgggggctcccgattg
accactggcagcagcattcaccgcagcatcgaaattcatctcgctcaatttttcggctcc
cccgacgcagtgtttttcgcttccggctatcaagcaaatgtcaccatcatctctacactt
gcaggaccacattgcaccatttattcagattcactcaatcacgcttccatcattgacggt
tgtcgactcagcaagtctcaagtaaagacttttcccaccggagattatgaagctctcgat
gccgcattagctcattgtgatactacgaattcgcttattattaccgacgcggtgttttcc
atgtctggcacaatcgcagatctcgaacagttacgccaagtagcagcccgacacggctca
tggttacttatcgacgacgcccacggaatcggttgcttaggaaacgcagggcgtggcact
gcgcatttgttcccccacgcaccgaccgatttctcgcaagaagtaatcgtcggtacgtca
agtaaagcccttggaggcgaaggcggcttcgctttatgctctgaacaggttgccaccttg
ttacgcaatcaagggcgcgggtatgtcttttcgaccgctccagcaccagcgacgatggca
actaccgatgctgcgctgacagttctagaacaagaaccagatcgtattcggaggctccaa
tccaatattgcgtacttcgcacagcgaagctcaaacgtagtcccatttcagaaaagcggc
tttttctcccctatcatttcgtacacaattggagacgaaaatgaagcactgaagtctgca
cagctgcttcgcgataatggattttttatcccagcaatcaggtacccgacagtaagccgt
ggaagtgccatgttgagaataacgatgaccgcaatgcattctcaccacgatattgatcaa
ctagctgatgcactcaatcaattagaaagtcaccgtttagataactcctag

DBGET integrated database retrieval system