KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1414Help
Entry
DIP1414           CDS       T00151                                 

Gene name
dtxR
Definition
(GenBank) diphtheria toxin repressor
  KO
K03709  DtxR family transcriptional regulator, Mn-dependent transcriptional regulator
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Brite
Transcription factors [BR:cdi03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DIP1414 (dtxR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe_dep_repr_C Fe_dep_repress MarR_2 HTH_24 MarR FeoA HemN_C HTH_1 HTH_27 HTH_Crp_2 Topoisom_bac
Motif
Other DBs
NCBI-ProteinID: CAE49945
UniProt: P0DJL7
Structure
PDB: 

Position
1431335..1432015
Genome map
AA seq 226 aa AA seqDB search
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR
SLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVL
KDVSRSPFGNPIPGLDELGVGNSDAAVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFT
QLLDADIRVGSEVEIVDRDGHITLSHNGKDVELIDDLAHTIRIEEL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttagtcgataccacagagatgtacttgcgtactatctatgagctggaagaa
gagggtgtcacccctcttcgcgctaggatcgctgagcgtctggaacaatctggacctaca
gttagccaaaccgttgcccgtatggagcgcgatggacttgtcgttgtcgcctcagaccgc
agtctacaaatgacaccgacaggccgcactttagcgactgcagttatgcgtaaacatcgc
ttagctgagcgccttcttaccgatatcattggcctagatatcaataaagttcacgatgaa
gcctgccgctgggaacacgttatgagtgacgaagttgaacgcaggctcgtgaaagtattg
aaagatgtcagtcggtcccccttcggaaacccaattccaggtctcgacgaactcggcgta
ggcaattctgacgcggcagtccccggaactcgcgttattgacgctgccaccagtatgccc
cgcaaagtacgcattgttcagataaatgaaatcttccaagttgaaacggatcagtttaca
cagctcctcgatgctgatatccgagttggatcagaagttgaaattgtagatagagacggc
cacatcacgttgagccacaatggaaaagatgtcgaacttatcgatgatctggcccacact
attcgtatcgaagaactctaa

DBGET integrated database retrieval system