KEGG   Corynebacterium diphtheriae NCTC 13129: DIP1850Help
Entry
DIP1850           CDS       T00151                                 

Definition
(GenBank) Ham1 family protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
cdi  Corynebacterium diphtheriae NCTC 13129
Pathway
cdi00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cdi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DIP1850
Enzymes [BR:cdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     DIP1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAE50379
UniProt: Q6NFN7
Position
complement(1894916..1895539)
Genome map
AA seq 207 aa AA seqDB search
MKVLVASNNAKKLGELRTILENAGLSSVEVVPLSAIDAYDEPVEDGRTFADNALIKARAG
AHHSGLITIADDSGFAVEELNGMPGVLSARWSGQHGNDATNNELVLAQMKHVPEERRHAA
FVSVCALVTPDGDEHIVEGRWEGRMLTAPRGANGFGYDPLFVPAEEDAAGTGRTSAEMSP
AEKNAISHRGKALQQLVPIIAGYSTFF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtactcgtagcctccaacaatgccaagaagctcggtgagctacgcaccatcttg
gaaaacgcaggtctgagcagcgtcgaggtagtgccgctttcggcaatcgacgcctacgac
gagcccgtagaagacggccgcaccttcgccgacaacgccctaattaaggcccgtgcgggt
gcacaccacagtgggcttatcacgattgccgatgactctgggttcgccgttgaagaactc
aacggaatgccaggggtgctgtctgctcgctggtctgggcaacatggcaatgacgcaacc
aacaacgagttggtgcttgctcagatgaaacatgtcccagaggagcgtcgacacgcggcg
tttgtgtccgtctgtgcgctcgtgacccccgacggcgacgaacacatcgtcgaggggcgc
tgggaaggtcgcatgctcaccgcaccccgcggcgccaacggcttcggttacgaccccctg
ttcgtacccgccgaagaagacgcagccggcactgggcgcacctcggcagaaatgagccca
gcggaaaagaacgccatctcacaccgcggcaaagcgcttcaacaactcgtccccatcatc
gcgggatacagcacatttttttaa

DBGET integrated database retrieval system