KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_00656Help
Entry
ERS451417_00656   CDS       T04861                                 

Gene name
nudC
Definition
(GenBank) NAD+ diphosphatase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
cdip00760  Nicotinate and nicotinamide metabolism
cdip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ERS451417_00656 (nudC)
Enzymes [BR:cdip01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     ERS451417_00656 (nudC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: CKG77241
Position
1:645861..646589
Genome map
AA seq 242 aa AA seqDB search
MFAINTCLRVDSAGRVPVAHGTPVTTTPCPHIATYPVTNDLCVQRVSDAEAEAVTGETKR
VTEGWVMKAIAVLHHRENTLFDPLTGGPLDFRNDSIAGATETGREVFPRIDPAVIGLIEL
AGQDRILIAENAQRRGFYSLIAGYVGLGETCEAAMVREALEETGRRISQVRYVRSQPWPY
SGALMMGMVATTTDEHPIQPLDGELGRITWASRSELREGVFTLPHRNSLAFQLITEWVGQ
HD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgattaacacctgccttcgtgtcgactctgcaggacgagtgccagtagcacac
ggaacgccggtcaccaccactccctgcccacatatcgctacctatccagtaacgaacgac
ctgtgtgtacaacgagtgtcagacgcggaagcagaagctgttacaggagaaaccaagcgg
gtgaccgagggctgggtaatgaaggctatcgctgtactacatcatcgagaaaacactctg
tttgatcctttgacaggtggcccactggactttcgcaacgactccattgcaggagcaacc
gaaactggtagagaagtctttcctcgtatcgatcccgcagtaatcgggctaatcgaactt
gcaggacaagaccgcatactcatcgctgaaaacgcccagcgtcgcggtttctactcgctc
attgcaggctatgtgggacttggtgaaacttgtgaggcagccatggtgcgagaagctctt
gaagaaaccggacgtcgtatttcgcaggtgcgctatgtgcgcagtcagccttggccctac
agcggtgcactcatgatgggcatggtggcaaccacaacagatgagcaccccatacaaccc
ctcgatggcgagctagggaggataacgtgggcgtcgcgaagcgagctccgcgaaggggta
tttaccttgccacataggaattctctagcgttccaattgatcacagaatgggtgggacaa
catgattaa

DBGET integrated database retrieval system