KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_00891Help
Entry
ERS451417_00891   CDS       T04861                                 

Gene name
rrmA
Definition
(GenBank) putative SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cdip03009]
    ERS451417_00891 (rrmA)
Enzymes [BR:cdip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ERS451417_00891 (rrmA)
Ribosome biogenesis [BR:cdip03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ERS451417_00891 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_32 TrkA_N
Motif
Other DBs
NCBI-ProteinID: CKG84174
Position
1:878298..879167
Genome map
AA seq 289 aa AA seqDB search
MLSHVVDVLADPMDGSALTLVDDNRRLVSESGHSFDIARQGYVILAGGAGIRYVGDDSSM
IHARETFLSGGHFAPFVEAVSNSVHLALDEANVPDDASPVICEVGAGTGYYLAHALDDIE
NSRGIGIDVSVPAAKMLSKCHPRVGAVVADAWSRLPLRDASIDAITVVFAPRNASEFARV
LKPGGQVIVLTADAGHLEELREPLGIIGVEKDKVQRMIDQAADNLVPVSDPEPIEFTMHL
DQDSIASQIGMSPSARHIHPDVLGERIATLPSVMDVTARAMITRFAKID
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtcgcatgttgtagatgttcttgcggatcccatggatggttctgcgttgacgctt
gtcgacgataaccgccgtctggtgtctgaatccggccatagttttgatattgcacgtcag
gggtatgtgatcctcgctggcggtgcaggtattcgatacgttggcgatgattcttctatg
atccacgcccgcgagacgttcctttcgggtggccatttcgcgccattcgtcgaggccgtg
agtaattccgttcacctcgccttggatgaggctaatgttccggatgatgcctctcctgtg
atttgtgaggtcggtgccggcactggctactacttggcacatgcactggatgacattgag
aactctcgcggcattggcattgacgtttctgtgccagcggcgaagatgttgagcaagtgc
catccacgcgtgggcgctgtcgtagcagatgcatggtcgcgattgccgcttcgcgacgcc
tctatcgatgccattaccgttgtctttgcacctcgtaacgcctccgagttcgcccgtgtg
ctcaaacctggcggccaagttatcgtattgacagccgacgcaggtcacctcgaagaactg
cgcgagcctctgggcattatcggcgtggaaaaggacaaagtccaacgcatgattgatcaa
gcagcagacaaccttgtgcctgtttctgatccagaacccattgagttcaccatgcactta
gatcaagactccatcgcctcccagatcggtatgagcccctcagctcgccatattcacccc
gatgtactaggagagaggattgccaccctccctagtgtcatggacgtgaccgcgcgtgcg
atgatcacacgttttgccaagatcgattag

DBGET integrated database retrieval system