KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_01317Help
Entry
ERS451417_01317   CDS       T04861                                 

Gene name
ribA
Definition
(GenBank) bifunctional 3%2C4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
cdip00740  Riboflavin metabolism
cdip00790  Folate biosynthesis
cdip01100  Metabolic pathways
cdip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ERS451417_01317 (ribA)
   00790 Folate biosynthesis
    ERS451417_01317 (ribA)
Enzymes [BR:cdip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ERS451417_01317 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     ERS451417_01317 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: CKG96175
Position
1:complement(1311642..1312964)
Genome map
AA seq 440 aa AA seqDB search
MRVDITRSGTPRNNEAYPIDQQNNDHPRVTLDSIERAIADIANGKPVVVVDSEDRENEGD
LIFAADKATPELVAFMVRYSSGYICASLTSEECDRLQLPPMTSHNEDARGTAYAVTVDAN
TGTTGISATSRADTLRKLADSQFGPQDFTRPGHVVPLRAKAGGVLERAGHTEAAVDLARM
AGLNPAGVLCEVVSEDDPTDMARAPELRRFADRHDLALISIEQLIEWRRRYELLVERAVS
TQLPTEFGRFTAVGYRGIVDGVEHIALVAGDISSDEGKDVLLRVHSECLTGDVLGSRRCD
CGPQLQASLRAISERGRGVVVYLRGHEGRGIGLLHKLQAYHLQDEGADTVDANKALGLPV
DARNYSVAAHILRDLGVQSVCLLTNNPEKSLELERYGVKVTGREPVKVEVHEDNIRYLTT
KRDRMNHDLPWIAEYNKEQS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtggatataacccgaagcggtacgcctcgtaacaacgaggcttacccgatagat
cagcagaataacgatcatccaagggtgactttggatagcatcgaaagggccatcgcggat
attgcgaatggaaagcctgtggtcgtagtcgactcagaagatcgtgaaaacgaaggcgat
ttaatttttgcggctgataaagcaacgccagagttagtagcctttatggttcgatattct
tcgggttatatatgtgcctctttgacgtcagaagagtgcgatcgacttcagcttccgcca
atgacatcccataacgaggatgcgcggggtaccgcatatgccgtcacggtagatgcgaat
acaggaacaactggtatttctgcaacaagtcgtgcagatacgttgaggaaacttgccgac
agtcaattcggacctcaagatttcacgcgtcctggccatgtggttccactgcgtgcgaaa
gcaggaggtgtgcttgaacgggcagggcatactgaagcggctgtcgatctagctcgaatg
gctggcttgaatccagcaggcgtcctgtgtgaagtcgtcagcgaagatgatcccacagac
atggcacgagcacctgaactacgacgatttgcggatcgacatgatcttgcacttatttcg
attgaacagcttattgagtggcgacgtaggtacgaattacttgttgaacgagccgtgtca
acacaactgccaactgagttcggacggtttaccgcggtcggctatcgtggaatcgttgac
ggtgtagaacatattgcgctagttgctggggatatttcttctgatgagggcaaggatgtt
ctccttagagtccattctgaatgcttgaccggagatgttttgggttctcgtcggtgtgac
tgtgggccgcaattacaagcgtcccttcgtgctatttccgagcgagggcgcggagtcgtg
gtgtacttgcgtggacatgaaggacgtggaatcggattacttcataagcttcaggcgtat
catctgcaagatgaaggggccgatacggttgacgcaaataaggcattaggcctaccagtt
gacgcccgtaattactctgttgctgcacacattctacgagatcttggcgtgcagtcagta
tgtttgctgacgaataatccagaaaaatcccttgaactggaacgctatggggtcaaagta
actggacgagagcctgtcaaagtggaagtgcacgaagataatattcgttatttgaccaca
aaacgggatcgaatgaaccatgatctgccatggattgccgaatacaacaaggagcaaagc
taa

DBGET integrated database retrieval system