KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_01622Help
Entry
ERS451417_01622   CDS       T04861                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
cdip00471  D-Glutamine and D-glutamate metabolism
cdip00550  Peptidoglycan biosynthesis
cdip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ERS451417_01622 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ERS451417_01622 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdip01011]
    ERS451417_01622 (murD)
Enzymes [BR:cdip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     ERS451417_01622 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cdip01011]
 Precursor biosynthesis
  Amino acid ligase
   ERS451417_01622 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C XdhC_C 3HCDH_N TrkA_N Pyr_redox Shikimate_DH NAD_binding_2 ADH_zinc_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CKH04529
UniProt: A0A0D6GLC2
Position
1:complement(1623004..1624446)
Genome map
AA seq 480 aa AA seqDB search
MSAAKMTVSVEELKVLLPELAGRVLVAGAGVSGVGITQLLREMGCAVTVADSNSAQLDKL
AQQTGCQIISPADVVSDGFQDYTVVVTSPGWRPDSPLLVAAQSAGLEVIGDVELVYRLDR
AEVFGPKRTWMVVTGTNGKTTTTAMLAEIMQHSGARAAAVGNIGVSVADAVSTQPRIDVL
VAELSSFQLHWSSTLIPDVGILLNLADDHIDWHGSFAQYAQDKAKVLAAPTAIAGFDNEH
VTTEMRRIQRAEDADPIIGFTLGEPAKGMVGVRDGQLFDCAFGDNVVLRSAEGIEPAGPA
GLNDALAAAAAARSMGVSAICVEEALSKFEVAGHRGQCVGRHREVVAIDNSKATNPHAAD
SALAGFSSVVWVAGGQLKGAEIDELIVRHAGRIKAVALLGVDRDVIEDSVRTHIPGIPVL
SVSETDPRRAMDEAVAWSVSQAEAGDAIVLAPAAASLDMYTGMGQRGDMFATAIAQHLHD
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgccaaaatgacagtaagtgttgaagagctcaaggttttgcttcctgagtta
gcgggccgcgtactcgtcgcaggtgccggtgtttccggagttggaatcactcagctgctg
cgagaaatgggatgtgctgtcaccgttgcagattccaattctgcgcagttggataagctt
gctcaacaaactggttgtcagattattagcccagctgatgtggtttcggatggttttcaa
gactacacagtggtggtcacttctccgggttggcgacctgattcgccgcttctcgttgct
gctcaaagcgctggccttgaggtgattggcgatgttgagctggtgtaccgactcgatcgc
gccgaggtatttggcccgaagcgaacctggatggtggttaccggtactaacggcaaaacc
actacaacggccatgctcgcagaaatcatgcaacattctggtgcgcgtgctgctgccgtc
ggcaacatcggtgtatcggttgcagatgctgtgagtacccaaccacgtattgatgtgtta
gttgcggagctgtcgagttttcagctgcattggtcttccactttgatccctgacgttgga
attttgctcaatcttgctgatgatcacattgattggcacggtagtttcgcccaatatgca
caggataaggcgaaagtattagccgctcccactgcaattgcgggctttgacaacgaacat
gtgacgacggaaatgagacgcatccaacgtgccgaagatgctgatcccatcatcggattc
acattaggcgagccagctaaaggcatggtaggcgtgcgcgatggacaacttttcgactgt
gcatttggcgataacgtggtgttgcgatctgctgaaggaatcgaacctgcaggtccggca
gggcttaacgacgcccttgctgcggctgccgcagcgcgctcgatgggagtgagtgccata
tgtgttgaagaagccctgtctaagtttgaagtcgcaggtcaccgtggacaatgcgtgggg
cgtcatagggaagtagttgcgattgataattcgaaagcaacgaatccacatgctgctgat
agcgcacttgctggtttctcttcagtagtgtgggttgctggtgggcagctcaagggagca
gaaatcgatgagctcattgttcgacatgccggacgaatcaaagcagtagcgttgttgggc
gttgatcgtgatgtgatagaagattctgttcggactcatattcctggtattccggtactg
agcgtttctgagactgatccacgtcgcgcaatggatgaggcggtagcgtggtcggtatcc
caagcagaggcaggcgatgcgatcgtattggctcctgcagcagctagtcttgatatgtac
accggcatggggcagcgtggagacatgttcgctacagcgattgcacaacatttacacgac
taa

DBGET integrated database retrieval system