KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_01635Help
Entry
ERS451417_01635   CDS       T04861                                 

Gene name
metF
Definition
(GenBank) 5%2C10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Pathway
cdip00670  One carbon pool by folate
cdip01100  Metabolic pathways
cdip01120  Microbial metabolism in diverse environments
cdip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ERS451417_01635 (metF)
Enzymes [BR:cdip01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ERS451417_01635 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: CKH04862
UniProt: A0A0D6GM48
Position
1:complement(1637230..1638213)
Genome map
AA seq 327 aa AA seqDB search
MSAQPLPAAYQRTITDVISMPTPGQVPFSVEFMPPRDEAAEERLWKAAEAFHDLGASFVS
VTYGAGGSSRERTMRVAHKLSRHPLTTLVHLTLVEHTQEELEEILCTYASHGLSNLLALR
GDPPGTDPMAPWVPTAGGLDYAKDLIDLVRKTEQTSHFQVGIASFPEGHYRAPSIEADTQ
FTLEKLRAGAEFSITQMFFDVDHYLRLRDRLVKADPEHGSKPIIPGLMPITSLRSVRRQM
ELAGATLPKALEKRLLDAARGDEEAHRGDIRKVGIEVTTEMAQRLISEGIPDIHFMTMNY
VRATQEVLHNLGMAPAWGTQQGHDAIR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacaaccgctacctgctgcgtatcagcgcacaatcaccgatgtcatttccatg
ccaacaccgggccaggttccgttttctgtagagtttatgccgccacgagatgaggcagca
gaagagcgactctggaaagctgccgaagcatttcacgacttaggagcctcttttgtctcc
gttacttatggtgcaggcggatctagccgcgagcgcacaatgcgtgtcgcgcacaagctt
tctcgtcatccgttgaccacgctcgttcatctcacgcttgtggaacacacccaagaagaa
ttagaagaaattctgtgcacttatgcgtcccacgggttgtctaacttacttgccttgcga
ggcgatccccctggcactgacccgatggctccgtgggtccctaccgcaggcggcctagat
tatgccaaagatttgatcgacctcgtgcgcaagactgagcagacctcacactttcaggta
ggaattgctagtttcccagaagggcactaccgagcgcctagcattgaggcggatacgcaa
tttacattggaaaagctgcgagctggcgcagagttttcgattacccagatgttttttgat
gtcgatcactatttacgactgcgagatcgcttggttaaggcggatcccgaacatggatca
aagccgatcatcccaggacttatgcccattaccagcttgaggtcggttcgtaggcagatg
gaattagcaggtgccaccttgcctaaggctttagaaaaacggcttctcgacgcagcgcgc
ggcgatgaggaagctcatcgcggcgatattcgcaaagtaggaatcgaagtcactactgag
atggcacagcgtcttatttctgaagggatcccagacatccatttcatgaccatgaattat
gttcgagcgacccaagaagtactccataatctcggcatggcgcccgcgtggggaacacag
caaggccacgacgctattcgctaa

DBGET integrated database retrieval system