KEGG   Corynebacterium diphtheriae NCTC11397: ERS451417_02152Help
Entry
ERS451417_02152   CDS       T04861                                 

Gene name
pitB
Definition
(GenBank) phosphate-transport permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cdip  Corynebacterium diphtheriae NCTC11397
Brite
KEGG Orthology (KO) [BR:cdip00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ERS451417_02152 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4041
Motif
Other DBs
NCBI-ProteinID: CKH17931
Position
1:complement(2168064..2169650)
Genome map
AA seq 528 aa AA seqDB search
MLSGAPFDQRSDKWWHLTFGGMLAVALIFFITWSMGYVGPEANKAMLITTIAFGVFMAFN
IGGNDVANSFGTSVGAGTLSMKQALVIAAIFEVSGAVLAGGEVTDTVKSGIVDLGAIDLD
PQHFAFIMMASLLGAAVWLLVATKMGWPVSTTHSIVGGIVGASLLLGFTQGIGGWEMVQW
AEIGRIAMSWVLSPLLGGLCAWLLFGFIKKHILVYNEEADEALRQIKADRIELHQSFKAS
FERLNEIQQLAYTNAMTRDAALIQEPDFDPEQLESDYYRNLYRINTRRDNLNTHRALENW
VPLLAAAGAALIGAMMLFKGLKNLNLHISNLGNVVILVMLSAVVWMAISIFSRLLRQQEL
TRATFVLFSWMQVFTASAFAFSHGSNDIANAIGPFSAVLDVLRTDSINGKAAVPTALMVT
CGISLIAGLWFIGRYVIHTVGTGLTKMHPASGFAAELSAAAVVMGASVIGLPVSSTHILI
GAILGIGVVNKSANWRLMKPIGMAWIITLPAAAAVSGAAVLVLNAVWG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtggcgctcccttcgatcagcgctccgacaaatggtggcacctcacctttggc
ggaatgctcgcagtggcgctgatcttcttcatcacatggtccatgggatacgttggcccc
gaagccaacaaagccatgctgatcaccacgatcgccttcggcgtattcatggccttcaac
atcggcggcaacgatgtggccaactcctttggcacctcggtgggtgcgggaacactcagc
atgaaacaagcgctggtgatcgccgcaatcttcgaagtatccggcgctgtcctcgcaggc
ggcgaggtcaccgacacagttaaatccggcatcgttgacctcggtgccatcgacctcgac
ccccaacacttcgccttcatcatgatggcctcgctcctcggagccgcagtatggctcctc
gtggccaccaagatgggctggccagtgtccaccacgcactccatcgtcggcggtatcgtc
ggtgcctcgctgctcttgggctttacccaaggaatcggcggctgggagatggtgcaatgg
gcagaaatcggccgcatcgcgatgtcctgggtgctttcgccactacttggtggcctctgt
gcgtggttgctcttcggctttattaaaaagcacattttggtctacaacgaagaagccgac
gaggcgcttcgccagatcaaagcagaccgcattgagctgcaccaatccttcaaagcctcc
ttcgagcgcctcaacgagatccagcagttggcctacaccaacgccatgactcgcgacgcc
gccttgatccaagaaccagacttcgacccagaacaactggagtctgactactaccgcaac
ctgtaccgcatcaatacccgacgcgacaacctaaacacccaccgtgcgttggaaaactgg
gtgccgctgctggctgctgcaggcgccgcccttatcggtgccatgatgctgttcaaaggg
cttaagaacctcaacttgcatatcagcaacttgggcaacgtggttatcctcgtgatgctc
tccgcagtagtctggatggccatttcgatcttctcccgactgctgcgccagcaagaactc
acacgggcaacctttgtgctgttctcttggatgcaggtatttaccgcctctgccttcgcg
ttttcccacggttcgaacgatatcgccaacgcaatcggaccattttccgcagtgcttgac
gtcctccgcaccgactccatcaacggcaaagccgcagtgccaaccgcactgatggtcacc
tgcggtatctcactgatcgccggcttgtggttcatcggccgctacgtgatccacaccgtg
ggcaccggattaaccaagatgcaccctgcctccggcttcgcagctgaactttccgccgca
gcggtagtcatgggcgcatccgtcatcggcttgccggtgtcttccactcacatcttgatc
ggcgcgatcctcggtatcggcgtggtcaacaaatccgccaactggcggctcatgaagccc
atcggcatggcatggattatcaccctgccggctgcagccgcagtatccggcgcagcagtg
ctcgtgctcaacgccgtgtgggggtaa

DBGET integrated database retrieval system