KEGG   Cuniculiplasma divulgatum: CPM_0390Help
Entry
CPM_0390          CDS       T04682                                 

Definition
(GenBank) PiT family transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cdiv  Cuniculiplasma divulgatum
Brite
KEGG Orthology (KO) [BR:cdiv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CPM_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: SJK84275
UniProt: A0A1N5T0N5
Position
I:380391..381293
Genome map
AA seq 300 aa AA seqDB search
MISLYIAIALIGILSAVVSGNNISAAVGTIVGSRIVSRHFGLTLGATGFSLGLIIEGRFL
SNSLFLIMPEKSNLILIVLGVSIIMFIIATLARIPLSLIMAIVGTSIGIGLRTGYNYDSL
YVIMIIALWIVAPILAILSSYFLNLNLSKIGVKNVWATARFYKLFLVTISFLTAFTLGAN
TFGLLASLERSSYLTIPTMIIAIFLGAAFMSSGVIRRISQDMYGMRYQNATVSLLVSSIL
VEGATFFALPLPSTQTLTSSVFGTGLSYKTKAMQIRPFLIIVIMWVVSPLLGMALGYLIA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgatttcactttatattgcaatcgctcttattggcatattgagcgcggtcgtttcaggc
aacaatatttctgcggctgtaggcactatagtcggctcccgaattgtatcaagacatttt
gggcttacacttggggcaacaggtttttctcttggtctgatcatagagggaagatttctc
tcaaactcattattcctcataatgcctgaaaaaagcaatctgatactcatagtacttgga
gtatcaattataatgttcattattgcaactttagctagaataccgctttctctcataatg
gcaatagttggtacatccattggaataggactgagaacagggtataattatgattccctg
tatgtaataatgataattgctctctggatcgtggctcctattctcgccatattatcctca
tattttctaaatcttaatctgagcaagataggcgtaaagaatgtatgggctacagcaaga
ttctataaactatttcttgtaactatctcgttcctaacagcttttactctaggggcaaac
acttttggccttctcgcctcacttgaaaggtcatcatacttaaccatccccacaatgata
attgcaatatttctaggagctgcattcatgagcagcggagttatccgaaggatttcgcag
gatatgtatggcatgagataccagaatgcaaccgtatcgcttctcgtatcaagcattctg
gtggagggtgccacatttttcgcactgccgcttccaagtactcaaacactcacatcaagt
gtcttcgggacaggtctttcttataaaacgaaggcaatgcagataagaccatttttgatc
attgtaatcatgtgggtcgtatcaccacttcttggcatggctctgggatatctgattgca
tag

DBGET integrated database retrieval system