KEGG   Cuniculiplasma divulgatum: CPM_1906Help
Entry
CPM_1906          CDS       T04682                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cdiv  Cuniculiplasma divulgatum
Pathway
cdiv00051  Fructose and mannose metabolism
cdiv00520  Amino sugar and nucleotide sugar metabolism
cdiv01100  Metabolic pathways
cdiv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdiv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CPM_1906
   00520 Amino sugar and nucleotide sugar metabolism
    CPM_1906
Enzymes [BR:cdiv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CPM_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase DUF4954 Hexapep_2 MITF_TFEB_C_3_N
Motif
Other DBs
NCBI-ProteinID: SJK85681
UniProt: A0A1R4A9N1
Position
I:complement(1837920..1839008)
Genome map
AA seq 362 aa AA seqDB search
MSLKGVLMAGGRGTRLRPITYAIPKPLVPIAGIPCMEYPIRSFAQAGIEDIIVTTGYKFE
ALISGLIKTKHQKQSILYSVEREPAGTAGSVKMVEGFLNDTFVVASGDVLADFDIEEAVR
SHRESGKIATIVLTKVEDPTQFGIVEDKNNIVKRFLEKPTAAEVFTNMVNAGIYILEPEI
FNHIPEDQTYDFAKELFPKLLREGVEINTYHGKGAWLDTGRPRELILANQLMSEKYGNEI
NETNFKGKMIIRERPAGSDFTVTGSCYIGEGVKIGKNALIENSTVYDNAVIAENCNVRDS
IIFENCSIGKKSTVSKSVIMKGTSIGKDCEVIESALSSNINIQDGSRIYNVSLSSESNNS
LD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaaagggagttttaatggccggtggaagaggaacaaggctgaggccaataacc
tatgcaatacctaaaccactggtacccattgctggtataccatgtatggaatacccaatt
agatcgtttgcacaggctggcattgaagatatcatagttactacaggatataaattcgaa
gcactgatttcaggattgataaaaacaaagcaccagaagcagagtatactgtattctgta
gagagagaaccagcaggaaccgcaggttctgtaaaaatggttgagggttttctgaatgat
acctttgttgtagcaagtggagatgttcttgctgactttgatatagaagaggcagtgagg
tcacacagggagagtggaaagattgcaaccatagtactaactaaagttgaagatccaact
cagtttggtattgttgaggataaaaataatattgttaagagattccttgagaaacctacc
gctgctgaggtttttacaaatatggtgaatgcaggaatatatattcttgaaccagaaata
ttcaatcatatacctgaagatcaaacttatgactttgccaaggaactctttcccaaacta
ttaagagaaggagttgagataaatacttatcacggcaagggagcatggcttgatacagga
agacccagggaacttattcttgcaaaccagctgatgtctgaaaagtatggtaatgaaata
aatgagaccaattttaaagggaaaatgataatcagggaaagacctgcaggatcagatttt
actgttacaggaagttgctatataggagaaggagttaaaattggaaagaatgccttaata
gagaattcaacagtttatgataacgcggtaatagcagagaactgcaatgtcagggattca
ataatatttgaaaactgtagtatagggaagaaatctactgtttcaaaatcggtaataatg
aaagggacttccattggaaaggattgtgaggtaatagagagcgctctctcatcaaacata
aatatacaggacgggtcaagaatttataatgtatctctttcttctgaaagtaataatagc
ctggattag

DBGET integrated database retrieval system