KEGG   Carnobacterium divergens: BFC22_01080Help
Entry
BFC22_01080       CDS       T05644                                 

Definition
(GenBank) PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM
  KO
K05881  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaM [EC:2.7.1.121]
Organism
cdj  Carnobacterium divergens
Pathway
cdj00561  Glycerolipid metabolism
cdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BFC22_01080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdj02000]
    BFC22_01080
Enzymes [BR:cdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     BFC22_01080
Transporters [BR:cdj02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   EI/HPr/EIIA hybrid protein
    BFC22_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: ANZ98771
Position
complement(237112..237483)
Genome map
AA seq 123 aa AA seqDB search
MSKLGVVVVSHVPQIAEGVVRLMREVAKDVSITSAGGTDENEVGTSFEKIQTAFDANEAE
ILLAFYDLGSAKMNLEMVMEMTDKEVHLFDTAFLESSYTAAALIQADASLEMIKEQIDPM
KIK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactaggtgttgtagtcgtttcacatgttcctcaaattgcagaaggagtcgtt
cgcttaatgcgagaagtggcaaaggatgtatcgattacctctgctggcggaacggatgag
aatgaagttggaacgagctttgaaaaaatccaaacagcttttgacgctaatgaagctgaa
attttattagctttctatgatttaggtagtgccaaaatgaatttagaaatggtaatggaa
atgacagacaaagaagtccatctatttgatacagcttttctagaaagtagctacacggcg
gcagccttgattcaagccgatgcatccttagagatgattaaagaacaaattgatccgatg
aaaattaaataa

DBGET integrated database retrieval system