KEGG   Carnobacterium divergens: BFC22_08670Help
Entry
BFC22_08670       CDS       T05644                                 

Definition
(GenBank) cysteine desulfurase NifS
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
cdj  Carnobacterium divergens
Pathway
cdj00730  Thiamine metabolism
cdj01100  Metabolic pathways
cdj04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:cdj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BFC22_08670
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BFC22_08670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdj03016]
    BFC22_08670
   03029 Mitochondrial biogenesis [BR:cdj03029]
    BFC22_08670
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cdj02048]
    BFC22_08670
Enzymes [BR:cdj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BFC22_08670
Transfer RNA biogenesis [BR:cdj03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    BFC22_08670
 Prokaryotic type
    BFC22_08670
Mitochondrial biogenesis [BR:cdj03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BFC22_08670
Prokaryotic defense system [BR:cdj02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   BFC22_08670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 MATalpha_HMGbox DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AOA00176
Position
complement(1860080..1861225)
Genome map
AA seq 381 aa AA seqDB search
MEKIYLDHAATSPVHPEVLEVTFHAMKEHYGNASSIHGFGREARKLLDEARSVFAKSIGA
KPIEIVMTSGGTESDNTAIIETALSRAHFGKHLITTAVEHHAVLEPMEYLESMGFEVTYL
PVDETGLVHLEDLIAAVRPDTSLVSVMYGNNEVGTIMNIQEIGAFLAETETYFHTDAVQA
YGLEDIDVKQDAIDLLSVSAHKINGPKGIGFLYINEEIHLPSFMRGGEQETKRRAGTENI
PAIVGFQRAVEIAEQERSKRRETYDGFRNQLIEGLKQAEIDFEINGNETHYLKHILNIWI
KGVSSEQLLMNLDLLGIGISAGSACTAGNMEPSHVLSAMFGKNSPRVKESVRVSFGLGTT
TEMIDEAVKQLSVVVKRLKHS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatatatttagatcacgctgcaacaagtccagtccatccagaagttttagaa
gtaacatttcatgcaatgaaagaacattacggaaatgcttctagtattcatggatttggt
cgagaagcaagaaaattattagatgaggcaagaagtgtctttgctaaaagtattggagct
aagcctattgaaatcgtcatgacaagtggcgggactgaaagtgataatactgcaattatc
gagacggctttatcaagagcccatttcgggaagcatttaattacaaccgctgtggagcat
catgctgttttagagccgatggagtatttagaatcaatggggtttgaagtgacttattta
ccagttgatgaaacaggcttggttcacttagaggatttaattgctgctgttcgtccagat
actagtttggtatcggttatgtatggcaataatgaagtaggtaccattatgaacattcaa
gaaatcggagcatttctagcagaaacagaaacttattttcataccgatgcagttcaagca
tatggcttagaagatattgatgtaaagcaagatgcaattgatttactatcggtctctgcc
cataaaataaatggaccaaaaggaattggctttctctatattaatgaagaaattcatttg
ccaagctttatgcggggtggcgagcaagaaacaaaacggcgtgcaggcacagagaatatc
cctgcaatcgttggttttcaaagagccgttgaaattgcagaacaagaacggagtaagcgt
cgtgaaacctatgatggttttagaaatcaattaattgaaggattaaagcaagctgaaatt
gattttgaaatcaatggcaacgaaacgcattatttaaaacatattctaaatatatggatt
aaaggcgtttcatctgaacaattattaatgaatttagacttattaggaattggcatttca
gcaggatcagcttgtaccgctggaaatatggagcctagtcatgtactaagtgctatgttt
ggcaaaaatagtccacgagtaaaagaatctgttcgtgtcagttttggtttaggtacaaca
actgaaatgattgacgaagcagtaaaacaattaagtgttgtagtaaaacgattaaaacat
tcataa

DBGET integrated database retrieval system