KEGG   Camelus dromedarius (Arabian camel): 105085973Help
Entry
105085973         CDS       T04642                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105085973 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105085973 (CREM)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105085973 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 105085973
NCBI-ProteinID: XP_031304577
Position
3
AA seq 358 aa AA seqDB search
MSKCGRKKYIKTNLRQMETLDCQQDGGVPGSVAESESAHLQAQTDPNSAPTLAQVSVAGP
GTGRGSPTVTLVQLPSGQTVHVQGVIQTPQPSGTPSPQIQAVQVVAIAEADDSAESEGVT
DSQKRREILSRRPSYRKILNELSSDVAGVPKIEEKSEEEGVPPHVAAMAVPTSIYQTSTG
QYIAIAQGGAIQISTPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS
QVVVQDEETELAPSHMAAATGDMPTYQIRAPATALPQGVVMAASPGSLHSPQQLAEEATR
KRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaaatatattaagacaaatctcagacaaatggaaacactt
gactgtcagcaggacggaggtgtaccaggctctgtggccgagagcgagtctgctcacctg
caggcgcagactgacccaaattcagcccccactttagcccaggtttctgtagctggacca
ggcaccggaagaggctcccccactgtgactctggtacagttaccttcgggccagactgtc
catgtccagggagtaattcagacaccacagccatcgggcaccccgtcaccacagatacag
gcggtgcaggtagtagccatcgcagaggctgatgactctgcagaatcagaaggtgtaact
gactctcagaaacggagagaaatcctttcacgaagaccctcttatagaaaaatactgaat
gaactttcctctgatgtggctggtgttcccaagattgaagaaaagtcagaggaggaaggc
gtgccccctcacgtggctgcgatggcagtgccgactagcatttaccagaccagcacgggg
caatacattgctatagcccaaggtggagcaatccagatttctaccccaggatctgacggt
gttcagggcctgcaggcattaacaatgacaaactcaggagctcctccgccaggtgctaca
atcgtacagtacgcagcgcagtcagctgatggcacacagcagttctttgtcccaggcagc
caggtggtggttcaagatgaggaaactgaacttgccccaagtcacatggctgccgccact
ggtgacatgcctacttaccagatccgggccccagctacggctctgcctcagggtgtggtg
atggctgcatctccgggaagcctgcacagcccccagcagctcgcagaggaggccacacgc
aaacgagagctgaggctgatgaaaaacagggaagccgctaaagagtgtcgacgtcggaag
aaagaatacgtcaagtgtctggagagccgcgtcgcggtgctggaggtccagaacaagaag
ctcatagaggaactggagaccttgaaagacatctgctctcctaagacagacgtgtag

DBGET integrated database retrieval system