KEGG   Camelus dromedarius (Arabian camel): 105086399
Entry
105086399         CDS       T04642                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5 isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    105086399 (RDH5)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     105086399 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 105086399
NCBI-ProteinID: XP_031319530
Position
12
AA seq 418 aa
MAKKRARALPACAKRWLQPAGSSSPSLSSPPSPTPHALNTLAPSPPAVDLALAVASVEAW
EDREQSFSSKAKAAASGVAVPASFPRRSLGCHLQVVWAPAMWLPLLLGVLLWAALWLLRD
RQSLPASDAFVFITGCDSGFGRLLALRLDQRGFRVLASCLTPSGAEDLQRVASSRLHTTL
LDVTDPQSVQRAAKWVETHVGEAGLFGLVNNAGVTGIIGPTPWQTREDFLPVLNVNTLGP
IGVTLALLPLLRQARGRVVNITSVLGRLAANGGGYCVSKFALEAFSDSLRRDVAPFGVRV
SIVEPGFFRTPVTNLESLEDTLQACWARLPPATKALYGEAFLTKYLKAQQRVMNLICDPD
LTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPASLVDAVLTWVLPKPAQAVS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccaagaagagggcccgggcactgccggcctgtgccaagcgctggcttcagcccgca
ggctccagctcccccagcctgtcctccccgccctcccccaccccacatgcacttaatact
ctggcacccagtccacctgctgtggacttggccttagctgtagctagtgtggaagcctgg
gaagaccgggagcagagtttctcaagcaaagcaaaagcagcggcgtcaggtgttgcagta
cctgctagctttccccgcaggagcctcggctgccacctgcaggtcgtttgggctccggcc
atgtggctgcctctgctgctgggagtcttgctctgggcagcgctctggttgctcagggac
cggcagagcctgccagccagcgatgctttcgtcttcatcaccggctgtgactcgggcttc
gggcgactcctggcactgaggctggaccagagaggcttccgggtcctggccagctgcctg
accccctcaggggcagaggacctacagcgggtggcctcctcccgcctccacaccaccttg
ctggatgtcactgatccccagagtgtccagcgtgcagccaagtgggtggaaacacatgtt
ggggaagcagggctttttggtctggtgaacaatgctggtgtgactggtatcatcgggccc
acaccttggcagacacgggaggatttccttccggtgctgaatgtgaacacactgggtccc
atcggggtcacccttgccctgctgcccctgctgcgtcaggcccggggccgggtggtcaac
atcaccagcgtcctgggtcgcctggcagccaatggagggggctactgtgtctctaagttc
gccctggaggccttctctgacagcctgaggcgggacgtggctccttttggggtacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgacaaacctggaaagtttagaagac
accctacaggcctgctgggcacggctacctccagccacaaaggccctctacggagaggcc
ttcctcaccaagtacctgaaagcgcagcagcgcgtcatgaacctgatctgtgacccagac
ctgaccaaggtgagcaggtgcctggagcacgccctgactgcccgtcaccccagaacccgc
tacagcccaggctgggacgccaagctgctctggctgcccgcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgctcaggcggtctcctga

DBGET integrated database retrieval system