KEGG   Camelus dromedarius (Arabian camel): 105086622Help
Entry
105086622         CDS       T04642                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    105086622 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105086622 (MAPK6)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105086622 (MAPK6)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105086622 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 105086622
NCBI-ProteinID: XP_010975469
Position
Un
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYPDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKRGKSKCERNGLVKAQIALEEASQQLTEKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLGALYQSSWDSQFVGG
REDCFLINQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGNEE
GFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctaggctctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagactcgaccatgataacattgtgaaggtg
tttgaaattcttggtcctagtggaagccagttaacagatgatgtgggctctcttaccgaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggcttttcatgtatcagctgctacgtgggctc
aaatacattcactcagcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatccc
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctcttcgcaggtgcacatgaacttgaacaa
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttgacagcagaagaagcgctttcccatccttacatgagcatttattct
tttccaatggatgagccaatttcaagtcatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcatagtcacatttataactgggaaaggtaccatgactgt
cagttttcagagcatgattggcctatacataataactttgacattgatgaagttcagctt
gacccaagagctctgtctgatgtcactgatgaagaagaagtacaagttgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaggatcctgcttttgacaccaattactct
actgagccttgttggcagtacccagatcatcatgaaaacaaatattgtgatctggagtgt
agccatacttgtaactacaaaatgaggtcgtcatcatatttagataacttagtttggaga
gagagtgaagttaatcattactatgaacccaagcttattatagatctttccaattggaag
gaacaaagcaaagaaaaatctgataagagaggcaagtcaaaatgtgaaaggaatgggttg
gttaaagcccagatagctctggaggaagcatcacagcaactgactgaaaaagaaagggaa
aagaatcaggggtttgactttgattcctttattgcaggaactattcagcttagctcacaa
catgagcctactgatgttgttgacaaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccgagaaaaacaggaaaaaggaatggcg
aatttggctcagttaggagccctgtaccagtcttcttgggatagccagtttgtgggtggt
agggaggactgttttcttataaatcagttttgttgtgaggtaaggaaggatgagcaaatt
gaaaaggaaaacacttacaccagttacttggacaagttctttagcaggaaagaagatact
gagatgctagaaactgagccggtagaggatgggaagcttggggagagaggaaatgaggaa
ggatttctgaacaacagtggggagttcctctttaacaagcagcttgaatccataggcatc
ccgcagtttcacagtccagttgggtcaccacttaagtcgatacaggccacattaacacct
tctgctatgaaatcttcccctcagattcctcataaaacatatagcagcattctgaaacat
ctgaactaa

DBGET integrated database retrieval system