KEGG   Camelus dromedarius (Arabian camel): 105087555Help
Entry
105087555         CDS       T04642                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04520  Adherens junction
cdk04910  Insulin signaling pathway
cdk04913  Ovarian steroidogenesis
cdk04923  Regulation of lipolysis in adipocytes
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
cdk04960  Aldosterone-regulated sodium reabsorption
Module
cdk_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105087555 (INSR)
   04015 Rap1 signaling pathway
    105087555 (INSR)
   04010 MAPK signaling pathway
    105087555 (INSR)
   04066 HIF-1 signaling pathway
    105087555 (INSR)
   04068 FoxO signaling pathway
    105087555 (INSR)
   04072 Phospholipase D signaling pathway
    105087555 (INSR)
   04022 cGMP - PKG signaling pathway
    105087555 (INSR)
   04151 PI3K-Akt signaling pathway
    105087555 (INSR)
   04152 AMPK signaling pathway
    105087555 (INSR)
   04150 mTOR signaling pathway
    105087555 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105087555 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105087555 (INSR)
   04923 Regulation of lipolysis in adipocyte
    105087555 (INSR)
   04913 Ovarian Steroidogenesis
    105087555 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105087555 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    105087555 (INSR)
   04213 Longevity regulating pathway - multiple species
    105087555 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    105087555 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105087555 (INSR)
   04931 Insulin resistance
    105087555 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105087555 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:cdk04090]
    105087555 (INSR)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105087555 (INSR)
Protein kinases [BR:cdk01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   105087555 (INSR)
CD molecules [BR:cdk04090]
 Proteins
  105087555 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 105087555
NCBI-ProteinID: XP_010976537
Position
Un
AA seq 1345 aa AA seqDB search
MDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLE
SLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLAT
IDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQK
VCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQD
WRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPK
VCHLLEGEKTIDSVTSAQELRGCTIVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKI
RRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHY
NPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSHDKILLKWE
PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPMRSNDPKSQNHPG
WLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQ
IILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKH
NQTEYEEAAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFIPRKSSSGPGAEDTRP
SRRRRALADIGNGTAAVPTLPGFPNASSTSAPTSSEEHRPFEKVVSKESLVISGLRHFTG
YRIELQACNQDAPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEP
NGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWT
EATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNP
EYLSASDVFPCSVYVPDEWEVPREKIALLRELGQGSFGMVYEGNARDIVKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRS
LRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGD
FGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPY
QGLSNEQVLKFVMDGGYLDQPDNCPDRVTNLMRMCWQFNPKMRPTFLEIVDLLKDDLHPS
FPEVSFFHSEENKAPESEELDMEFEDMESVPLDRSAHSQREEAGGRDAGSALGLKRGYEE
HIPYTHMNGGKRNGRILTLPRSDPS
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atggacatccggaacaacctcacccggctgcacgagctggccaactgctccgtcatcgaa
ggacatctgcagatactgctgatgttcaaaacgaggcctgaggatttccgagacctcagt
ttccccaaactcatcatgatcaccgattacttgctgctcttccgggtctacgggctggag
agcctgaaggacctgttccccaacctcacggtcatccggggctcccgcctcttcttcaac
tacgcgctggtcatcttcgagatggttcacctgaaggagcttggcctctacaatttgatg
aacattacgcggggctcggtccgcatcgagaagaacaatgagctctgctacctggccacc
atcgactggtcgcgcatcctggactccgtggaggataattacatcgtgctgaacaaagat
gacaacgaggaatgtggggacatttgtccaggcactgccaagggcaaaaccaactgccct
gccactgtcatcaatgggcaatttgtcgagcggtgttggacgcacagccactgtcagaaa
gtttgtccgaccatctgcaagtcgcacggctgcaccgcagagggcctctgctgccacagc
gagtgcttgggtaactgctccgagcccgacgaccccaccaagtgcgtggcctgccgcaac
ttctacctggacggccgctgcgtggagacctgcccgcccccctactaccacttccaagac
tggcgctgcgtgaacttcagcttctgccaggatctgcacaacaaatgcaagaactctcgg
aggcagggctgccaccagtacgtcattcacaataacaagtgcatccctgagtgtccctct
gggtacacgatgaattccagcaacttgatgtgcactccatgcctgggcccctgtcccaag
gtctgccacctcctggaaggtgagaagaccatcgactcagtgacgtccgcccaggagctc
cgaggctgcaccattgtcaacgggagcttaatcatcaacattcgagggggcaacaatctg
gcagctgagctggaggccaaccttggactcattgaagaaatttcagggtacctgaaaatc
cgccggtcctacgccctcgtgtcactttccttcttccggaagttacgtctgattcgagga
gagaccttggagattgggaactactccttctacgccttggacaaccagaacctaaggcag
ctgtgggactggagcaaacacaacctcaccatcacgcaggggaaactgttcttccactat
aaccccaagctctgcttgtcggaaattcacaagatggaggaagtttcaggaaccaagggg
cgccaggagagaaacgacattgccctgaagaccaatggggaccaggcgtcctgtgaaaat
gaattacttaaattctcttacattcggacatctcatgacaagatcttgctgaaatgggag
ccctactggccccctgacttccgagatctcttggggttcatgcttttctacaaagaggcc
ccttatcagaacgtgacggagttcgatggacaggatgcgtgcggctccaacagctggacg
gtggtggacattgacccgccgatgaggtccaatgaccccaagtcacagaaccaccccggg
tggctgatgcggggtctcaagccctggacccagtacgccatctttgtcaagaccttggtc
accttttctgacgaacgccgcacgtacggggccaagagcgacatcatctatgtccagaca
gatgccactaatccttccgtcccgctggatcccatctcggtttctaattcctcgtcccag
attattctgaagtggaagcctccctctgaccccaacggcaacatcacacactacctggtt
ttctgggagaggcaggcggaagacagcgagctgtatgaattggattattgcctcaaaggg
ctgaagctgccgtcccggacctggtctccgccgtttgagtctgagggctcccagaagcac
aatcagaccgagtacgaggaggctgccggagagtgctgctcctgcccgaagaccgactct
cagatcctgaaggagctggaggaatcctcgttccggaagacatttgaggattacctgcac
aatgtggttttcatccccagaaaatcctcttcaggccctggcgcggaggacaccaggccg
tcgcggagacgcagggccctggctgacatagggaatggcacagcggccgtgcccacgctc
ccggggttccccaacgcctcctccaccagcgcacccaccagctcagaggagcacagaccc
ttcgagaaagtggtgagcaaagagtcactggtcatctcggggctgcgtcactttaccggc
taccgcatcgagctgcaggcttgcaaccaagatgcccccgaggagcggtgcagcgtggcc
gcctacgtcagcgccaggaccatgcccgaagccaaggccgatgatattgtgggccccgtg
acccacgaaatcttcgagaacaacgtcgtccacctgatgtggcaggagcccaaggaaccc
aacggtctgatcgtgctctatgaagtgagctaccgacgatacggcgatgaggagctgcac
ctgtgcgtctctcgaaggcatttcgctctggagcggggctgcaggctgcgcgggctgccg
cccgggaattacagcgtgagagttcgggccacctccctggcgggcaacggctcctggaca
gaagccacttatttctatgtgacagattatttagacgtcccatcaaatattgcaaagatt
atcatcggccccctcatctttgtgtttctcttcagtgttgtgattgggagtatttatctg
ttcctgagaaagaggcagccggatgggccactgggaccactgtatgcttcttcgaacccc
gagtacctcagtgccagcgatgtgttcccgtgttctgtgtacgtgccggacgagtgggag
gtgccccgggagaagatcgcgctgctgcgagagctcgggcagggctccttcggcatggtg
tacgagggcaacgccagggacatcgtcaagggcgaggcggagacccgcgtggcggtgaag
acggtcaacgagtcggccagcctgcgagaacggattgagtttctcaacgaggcctcggtc
atgaagggcttcacctgccaccacgtggtccgcctcctgggggtggtgtccaaaggccag
ccgacactggtggtgatggagttgatggctcacggagacttaaagagctacctccgttcc
ctgcggccggaggccgagaataaccctggtcgccctccccctacgctgcaagagatgatt
cagatggcggcggagattgccgatgggatggcgtacctgaacgccaagaagttcgtgcac
cgggacctcgcagctcggaactgcatggtcgctcatgattttaccgtcaaaatcggagac
tttggaatgaccagagacatctacgaaacggactactaccggaaagggggcaagggcctg
ctccccgtgcggtggatggcacccgaatccctgaaggacggggtcttcaccacttcttcc
gacatgtggtccttcggcgtggtcctctgggaaattaccagcttggcagaacagccttac
caaggcctatctaatgagcaggtgttgaaattcgtcatggatggagggtatctggatcaa
cctgacaactgtccagacagagtcaccaacctgatgcgcatgtgctggcagttcaacccc
aagatgcggccgaccttcctggagatcgtcgacctgctcaaggacgacctgcaccccagc
tttcccgaagtttccttcttccacagcgaggagaacaaggcgccggagagcgaggagctg
gacatggagtttgaggacatggagagcgtcccgctggaccggtcggcacactcgcagcgg
gaggaggccgggggccgggacgcggggtcggcgctggggctgaagcggggctacgaggag
cacatcccctacacccacatgaacgggggcaagaggaacggccgcatcctgaccctgccg
cggtccgacccttcctaa

DBGET integrated database retrieval system