KEGG   Camelus dromedarius (Arabian camel): 105088625Help
Entry
105088625         CDS       T04642                                 

Gene name
XPO5
Definition
(RefSeq) exportin-5 isoform X1
  KO
K14289  exportin-5
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105088625 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdk03016]
    105088625 (XPO5)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105088625 (XPO5)
Transfer RNA biogenesis [BR:cdk03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    105088625 (XPO5)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     105088625 (XPO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 105088625
NCBI-ProteinID: XP_010977823
Position
20
AA seq 1200 aa AA seqDB search
MAMDQVNALCEQLVKAVTVMMDPSSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQI
AIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMELIANGTLNILEEENHIKDVLSRIV
VEMIKREWPQHWPDMLIELDILSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMERIFSFLLNTLQENVNKYQQVKTDNSQDPKAQANCRVGVAALNTLAGYIDWVSM
NHITAENCKLLEMLCLLLNEQELQLGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGVDSDVETPTNFGKYLESFLAFT
THPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTSIDTGSMN
SGTGEGRLCSIFSPSFVQWEAMTFFLESVINQMFRTLDKEEIPVNDGIELLQMVLNFDTK
DPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTFETIEESKAPRTRAVRNVRRHA
CSSIIKMCRDYPQLVLPNFDMLYSHVKQLLSNELLLTQMEKCALMEALVLISNQFKNYER
QKVFLEELMAPVAGIWLSEDMHRVLSDVDAFIAYVGADRKSCEPGLEDPCGLNRARMSFC
VYSILGVVKRTCWPTDLEEAKAGGFVVGYTPTGNPVFRNPCTEQILKLLDNLLALIRTHN
TLYAPEMLAKMAEPFTRALDMLEAEKSAILGLPQPLLELNDSPVYKTVLERMQRFFCTLY
ENCFHILGKAGPSMQQDFYTVEHLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLVLFCP
PEHYEALVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDETTEENPESQEMLEEQLVRM
LTREVMDLITVCCVSKKSADHGAAPAADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDV
CTALLITAFNSLAWKDTLSCQRTTTQLCWPLLKQVLSGTLLADAVTWLFTSVLKGLQTHG
QHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQKVADK
RRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEVLDNEEGGLATIFEP
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatcaagtgaacgcgctgtgcgagcagctggtgaaagcggtgacggtcatg
atggaccccagctccacccagcgctaccggctagaagccctcaagttttgtgaggagttt
aaagagaagtgccctatctgtgtcccctgtggcttgcgattggctgagaaaacacaaatt
gccatcgtcagacattttggccttcagatcctggaacatgttgtcaagtttcggtggaac
agcatgtctcgattggagaaggtctatctgaagaacagtgtcatggagctgattgcaaat
ggaacactgaacattttggaagaggagaaccatattaaagatgttctgtctcgaattgta
gtagaaatgatcaagcgggagtggccacagcactggcctgacatgctaatagaattggac
atcctttccaaacaaggggaaacacagacagaattagtgatgttcatccttttgcgactg
gcagaagatgtagtgacctttcagactctaccccctcaaagaagaagggatatccagcaa
acattaacccagaacatggaaagaatcttcagttttctactcaacacacttcaagaaaat
gtaaacaagtaccaacaagtgaagacagataattctcaggacccaaaggcccaagcaaac
tgtcgagtaggagtcgcagcactgaatactctagcgggctacattgactgggtgtccatg
aaccacatcactgctgaaaactgtaaactcctggagatgctgtgcctgcttctgaatgaa
caggaactgcagttgggagcagccgagtgtctcctcatcgcagtcagcagaaaaggcaaa
ttggaagaccggaagcccctgatggtcttatttggagatgtcgccatgcactatatactc
tctgctgcacagactgctgatggagggggcttggtagaaaaacactacgtcttcctgaag
agactctgtcaggtgttgtgtgctctgggcaatcagctgtgtgcattgctgggtgtggat
tcagatgtagaaacaccaacaaacttcggaaaatacttggaatcttttcttgctttcaca
acccatccaagtcagtttctacgctcttcaactcagatgacttggggagccctcttccgg
catgagatcctatctcgtgaccctttgttgttagcaataataccaaagtatcttcgtgct
tctatgactaacttggtcaagatgggctttccttctaaaacagacagccccagctgtgag
tactctcgatttgattttgatagtgatgaggacttcaatgctttcttcaactcctctcgg
gcccaacaaggagaggtaatgaggttagcatgtcgcttggatcccaagactagcttccag
atggctggggagtggctaaagtatcagctctcaacatctattgataccggatccatgaac
tctggaactggagaaggcaggctctgctccatcttctcaccttcatttgtacagtgggaa
gccatgacttttttcctggaaagtgtaatcaaccagatgtttcgaacactagataaagaa
gaaattcctgttaatgacggaatagagctgttgcagatggtcctgaactttgacaccaag
gatcccctcatcctgtcctgtgtcctcactaacgtctcagcactctttccatttgtcact
tacagaccagagttcctgccccaggtcttctctaagctattttcatctgtcacttttgaa
accattgaagaaagtaaggctccaaggacccgggcggtgaggaatgtgcggagacatgct
tgttcctccatcatcaagatgtgtcgtgactacccccagcttgtgctgcccaattttgac
atgctgtatagccatgtgaagcagctcctctccaatgagctgctcctgacacagatggag
aagtgtgccctcatggaagccctggttctcatcagcaaccagttcaagaactacgagcgt
cagaaggtgttcctagaggagctgatggcacccgtggccggtatctggctttctgaagac
atgcacagagtgctatcagatgttgatgcttttatagcctatgtgggtgcagatcggaag
agctgtgagcctggcctggaggatccctgtggcttaaaccgtgcacgaatgagcttttgt
gtgtatagcattctgggtgttgtgaagcgaacttgctggcccactgacctagaggaggcc
aaagctgggggatttgtggtgggttatacacccactggaaatccagtcttccgtaacccc
tgcacagaacagattctgaagcttcttgacaatttgcttgcccttataagaactcacaat
actttatatgcaccagaaatgctagccaaaatggcagaacctttcacaagggctctggat
atgcttgaagcggaaaaatctgctattttaggattacctcagcctctcttggaactgaat
gactctcctgtctacaaaacggtcttggaaagaatgcagcgtttcttctgcaccctctat
gaaaactgtttccatatcctggggaaggcaggcccttccatgcagcaggacttctacacc
gtggagcacctggccacgcagctcctcagctctgccttcgtcaacctgaacaacattcct
gactaccggctcagacccatgcttcgggtctttgtgaagcctctggtgctcttctgcccc
ccggagcactatgaagccctggtgtctcccatccttggacctcttttcacctacctccac
atgaggctttcccaaaaatggcaagtcatcaaccagaggagcctgctatgtggagaagat
gagacaacagaagaaaacccagagtctcaagagatgctggaagaacaactggtgaggatg
ttaacccgagaagtcatggacctaatcactgtgtgctgtgtttcaaagaaaagtgctgac
catggtgctgcccccgctgcagatggagatgatgaagagatgatggccacagaggtcacc
ccctcagccatggcagagctcacagacctggggaaatgcctgatgaagcatgaggatgta
tgtacagcgctattaattacagccttcaattccctggcctggaaggatactctgtcctgc
cagaggacgaccacacagctctgctggcctctcctcaaacaagtgctgtcagggacgctg
ctcgcagatgctgtcacgtggcttttcaccagcgtgctgaagggcttacagacacacggg
cagcacgacggctgcatggcctccctggtccacctggccttccagatctacgaggcgctg
cgtcccaggtacctggagataagagctgtgatggagcagatccctgaaattcagaaggac
tccctggaccagtttgactgcaagcttttgaacccttctctgcagaaagtggcggacaag
cgccggaaggaccaattcaaacgcctcattgctggttgcattgggaaacccctgggtgag
cagttccgaaaagaagttcacattaagaatcttccctcacttttcaaaaaaacaaagcca
atgctggagacggaggtgctggacaatgaggagggcggcctggccaccatctttgaaccc
tga

DBGET integrated database retrieval system