KEGG   Camelus dromedarius (Arabian camel): 105088859Help
Entry
105088859         CDS       T04642                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00511  Other glycan degradation
cdk00600  Sphingolipid metabolism
cdk01100  Metabolic pathways
cdk04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105088859 (GBA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    105088859 (GBA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105088859 (GBA)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     105088859 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 105088859
NCBI-ProteinID: XP_010978115
Position
Un
AA seq 536 aa AA seqDB search
MELSSPSREGRPKCQGRVGIIAVCLMGLLLFQAVSWASGARPCIPKSFGYSSVVCVCNAT
YCDSLDPLTLPDPGTFSCFESTRSGRRMELSLGNFQANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSLPARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTYADAPDD
FQLLNFSLPEEDVKLKIPLIHQAQELAKRHVSLFASPWTSPTWLKTNGKVNGKGSLKGHP
GDLYHQTWARYFIKFLDAYAKHKLQFWAVTAENEPSAGLFSGYPFQCLGFTPEHQRDFIA
RDLGPILANSTHRDVRLLILDDQRLLLPHWAQVVLTDPEAAKYIHGIAVHWYLDFLAPAK
ATLGETHRLFPDTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDW
NLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASKK
NDLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAMGFLETISPGYSIHTYLWRRQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagctttcaagtccttccagagaggggcgtccgaagtgccagggcagagtgggcatc
atcgctgtctgcctcatgggattgcttctatttcaggcagtatcgtgggcctcaggtgcc
cgcccctgcatccctaaaagctttggctacagctcagtggtctgtgtttgcaatgccaca
tactgtgattctcttgaccccctgaccttgcctgaccctggcaccttcagctgctttgag
agcacacgcagtgggcgccgaatggagctgagtctggggaactttcaggccaaccgcaca
ggcacagggctgctgctgaccctgcagccagatcagaagttccagaaagtgaaaggattt
ggaggggccatgacagacgctgctgcactcaacatccttgccctgtcactcccagcccgg
aatttgctgctcaaatcatacttttcggaagaaggaattgaatacaacattatccgggtc
cccatggccagctgtgacttctccatccgcgtctacacctatgccgatgcccctgatgac
ttccagttgctcaacttcagcctcccagaggaagatgtcaaactcaagatacccctgatt
caccaagcccaggagttggccaagcgccatgtttcactctttgccagtccctggacatca
cccacttggctcaagaccaatgggaaagtgaatgggaagggctcactcaagggtcatccg
ggggatctctaccaccagacctgggccagatacttcatcaagttcttggatgcctatgcc
aagcacaagttacagttctgggcagtgacagctgagaacgagccttctgcagggctcttt
agcgggtaccccttccagtgcctgggcttcacccctgaacaccagcgagatttcatcgcc
cgtgacctgggtcccatcctcgccaacagtacgcaccgtgatgtccgtctgctcatactg
gatgaccaacgcttgctgctgccccactgggcccaggtggtgctaacggacccagaggca
gctaagtacattcatggaattgctgtacattggtacctggactttctggctccagcaaaa
gccaccctgggggagacacaccgcctgttccccgacaccatgctctttgcctctgaggcc
tgtgtaggctccaagttttgggagcagagtgtgcggctgggctcctgggatcgagggatg
cagtacagccacagcatcatcacgaacctcctctaccacgtggttggctggaccgactgg
aaccttgccctaaaccctgaagggggacccaattgggtgcgtaacttcgttgacagcccc
atcatcgtggacatcaccaaggacacattttacaaacagcccatgttttaccaccttggc
cacttcagcaaattcattcctgagggctcccagagagtggggctggttgcgagcaagaag
aacgacttggacacagtggcactgatgcatcccgacggctctgcagttgtggttgtgcta
aaccgctcctctaaggatgtgcctctcaccatcaaggatcctgccatgggcttcttggag
actatctcacctggctattccattcatacctacctgtggcgtcgccagtga

DBGET integrated database retrieval system