KEGG   Camelus dromedarius (Arabian camel): 105089475Help
Entry
105089475         CDS       T04642                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00140  Steroid hormone biosynthesis
cdk01100  Metabolic pathways
cdk04913  Ovarian steroidogenesis
cdk04925  Aldosterone synthesis and secretion
cdk04927  Cortisol synthesis and secretion
cdk04934  Cushing syndrome
Module
cdk_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
cdk_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    105089475
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    105089475
   04925 Aldosterone synthesis and secretion
    105089475
   04927 Cortisol synthesis and secretion
    105089475
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105089475
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     105089475
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     105089475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind KR NmrA Sacchrp_dh_NADP Ilm1 Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 105089475
NCBI-ProteinID: XP_010978830
Position
Un
AA seq 373 aa AA seqDB search
MSGWSCLVTGGGGFVGQRIVRLLVEEKDLQEIRLLDKVFKSEVREEFSKLQSKIKLTMLE
GDILDKQCLKDACQGISVVIHTAAIIDVVNAVQQETIMNINVKGTQLLLEACVQASVPIF
IYTSTIEVAGPNSYKEVIQNGHEEEHLESRWPAPYPQSKKLAEKAVLEANGCALKNGGTL
YTCSLRPMYIYGERSPFLSGHIDCALKNNGMLTNYGRFSVVNPVYVGNVAWAHILALRAL
RDPRKAPSIQGQFYYISDDTPHQSYDDLNYALSKDWGFRLDSRMNLPISLQYWLAFLLEM
VGFLLSPIYKYKPTFSRHLVTLSNSVFTFSYKKAQRDLGYEPLFTWEEASQNTTEWVGSL
VRQHRETLKTKTH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggtggagctgccttgtgacaggaggaggaggctttgtgggtcagaggatcgtc
cgcttgttggtggaggagaaggatctgcaggagatccggctcctagacaaagtcttcaaa
tcagaagttcgagaggaattttctaagctccagagcaagatcaagctgaccatgctggag
ggagacattctggataagcagtgcctgaaggacgcctgccagggcatctcagtggtcatc
cacacggccgccatcattgacgtcgtgaatgccgtgcagcaggagaccatcatgaacatc
aacgtgaaaggtacccagctcctgttggaggcctgtgttcaggcgagtgtgcccatcttc
atctataccagcaccatagaggtggctgggcccaactcctacaaagaggtcatccagaat
ggccacgaagaagagcatctcgaaagccgatggcccgctccatatccacaaagcaaaaag
cttgctgagaaggctgtgctggaagctaatgggtgcgctcttaaaaatggtggcactttg
tacacttgctccttacggcccatgtatatctatggggagaggagccccttcctttctggc
cacatagactgtgccctgaagaacaatggcatgctgacaaattacggcaggttctccgtc
gtcaacccagtttatgttggcaatgtggcctgggcccatattctggccttgagggccctg
cgggaccccagaaaggccccaagcatccaaggacagttctactacatctcagacgacacg
cctcaccaaagctatgatgacctcaattacgctttgagcaaagactggggcttccggctt
gattccagaatgaaccttcctatttctctgcagtattggcttgccttcctgctggaaatg
gtgggcttcttgcttagtccaatttacaaatataagcccaccttcagccgccacctcgtg
acactatcaaacagtgtgttcaccttctcctataagaaagctcagcgagatctggggtat
gaacccctcttcacgtgggaggaagccagccagaataccacggagtgggttggctccctg
gtgagacagcacagggagaccctgaaaacaaagactcactga

DBGET integrated database retrieval system