KEGG   Camelus dromedarius (Arabian camel): 105089654Help
Entry
105089654         CDS       T04642                                 

Gene name
POR
Definition
(RefSeq) P450 (cytochrome) oxidoreductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105089654 (POR)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     105089654 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF3149
Motif
Other DBs
NCBI-GeneID: 105089654
NCBI-ProteinID: XP_010979045
Position
Un
AA seq 670 aa AA seqDB search
MGDSSVDAGATAAETVTEEVSLFSTMDMILFSLIVGLLTYWFFFRKKKEEIPEFTKIQPM
TSSVKDSSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLA
DLSSLPEIENALAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFGLGNKTYEH
FNAMGKYVDKRLEQLGAQRIYELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHPDIEAAKVYVGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQGTERHL
MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDVVMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEQLRKMASSSGEGKELYLSWV
VEARRHILAILQDSPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYET
KSGRINKGVATSWLRAKEPAGENGRRALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPF
MGFIQERAWLQQQGEWGGRRSDEDYLYREELAKFHKDGALTQLNVAFSREQPQKVYVQHL
LKRDKEHLWKLIHDGGAHIYVCGDARNMARDVQNTFYDIVAEQGAMEHAQAVDYVKKLMT
KGRYSLDVWS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccagcgtggatgccggtgccacggcggctgagacagtgacggaagaggtg
tccctcttcagcacaatggacatgatcctgttttctctcattgtgggtctcctgacctac
tggttcttcttcaggaagaaaaaagaagaaatccctgagttcaccaaaattcagcccatg
acctcctctgtcaaagacagcagcttcgtggaaaagatgaagaagacgggcaggaacatc
atcgtgttctacggctcccagacggggaccgccgaggagtttgccaaccgcttgtccaag
gacgcccaccgctacgggatgcggggcatggctgcggaccccgaggagtacgacttggcc
gacctcagcagccttccggagatcgagaatgccctggcagtgttctgcatggccacctac
ggtgagggggaccccactgacaatgcccaggacttctacgactggctccaggagacagac
gtggacctctctggagtcaagtatgcggtgtttggccttgggaacaagacctacgagcac
ttcaatgccatgggcaagtatgtggacaagcggctggagcagcttggagcgcagcggatc
tatgagctggggctgggtgacgacgatgggaacttggaagaggatttcatcacatggcga
gagcagttctggccggccgtgtgcgagcactttggggtggaagctactggagaggagtcc
agcattcgccagtatgagcttgtagtccacccagacatagaagcagccaaggtgtatgtg
ggtgagatgggccgtctgaagagctatgagaaccagaaacccccctttgatgccaagaac
ccattcttggctgtcgtcaccaccaatcggaagctgaaccagggaactgagcgacacctc
atgcacctggaattagacatctcagattccaaaatcaggtatgaatctggggaccatgtg
gccgtttacccggccaacgactctgccttggtcaaccagcttggtgagatcctaggtgcc
gacctagacgtcgttatgtccctcaacaatctcgacgaggaatctaacaagaagcacccg
ttcccctgccccacctcctaccgcacggcccttacctactacctggatatcaccaacccg
ccacgcaccaatgtgctctacgagctggcccagtacgcctcggagccctcggagcaggag
cagctgcgcaagatggcctcctcctcgggcgagggcaaggagctgtacctgagctgggtg
gtggaggcccggaggcacatcctggccatcctgcaggactccccgtccctgcggcccccc
atcgaccacctgtgtgagctgctgcctcgtctccaggcccgctactactccatcgcctcg
tcctccaaggtccaccccaactccgtgcacatctgtgccgtggccgtggagtatgaaacc
aagtctggccgcatcaacaagggcgtggccaccagctggttgcgggccaaggagccagcc
ggggagaacggccgccgggccctggtgcccatgttcgtgcgcaagtcccagttccgcctg
cccttcaagtccaccacgcctgtcatcatggtgggccccggcactgggatcgcccccttc
atgggcttcatccaagagcgggcctggctgcagcagcagggtgagtggggtggccgncgc
tctgacgaggactacctgtaccgtgaggagctggccaagttccacaaggatggcgccctc
acccagctcaacgtggccttctcccgggagcagccccagaaggtctatgtgcagcactta
ctgaagcgggacaaggagcatctgtggaagctgatccatgacgggggtgcccacatctac
gtctgcggggatgctcggaacatggcgagggacgtgcaaaacaccttctatgacattgtg
gccgagcagggggccatggagcacgcccaggccgtggactatgtcaagaagctgatgacc
aagggccgctactccctggacgtttggagttag

DBGET integrated database retrieval system