KEGG   Camelus dromedarius (Arabian camel): 105089804Help
Entry
105089804         CDS       T04642                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    105089804 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cdk01002]
    105089804 (ABHD6)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105089804 (ABHD6)
Peptidases [BR:cdk01002]
 Serine Peptidases
  Family S33
   105089804 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr FSH1 DUF1057 DLH Lipase Esterase Thioesterase
Motif
Other DBs
NCBI-GeneID: 105089804
NCBI-ProteinID: XP_010979222
Position
Un
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVRYVHHGDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNQFVQRLKELQESATVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVNEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLLVDFLASVHNTDNNKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgacgtagttaacatgtttgtgatcgcgggggggacgctggccatcccgatc
ctggcctttgtagcctcgtttctcctgtggccttctgcactgataagaatctactactgg
tactggcggagggcgctgggcatgcaggtccgctacgtccaccatggcgactatcagttc
tgctactctttccgtggcaggcctggccacaagccttccatcctcatgctccacggattc
tctgcgcacaaggatatgtggctcagcgtggtcaagttcctaccaaagaacctgcacttg
gtctgcgtggacatgccaggacatgagggtaccacccgctcctctctggatgacctgtcc
atagacggtcaagtcaagaggatacaccagtttgtagaatgcctgaagctgaacaaaaaa
cccttccacctgattggcacctccatgggcggccacgtggctggggtgtatgctgcctac
tacccatcagatgtctgcagcctgtctcttgtgtgtcctgctggcctgcagtactcaact
gataatcagtttgtacagcggcttaaagaactgcaggagtcagccaccgtcgagaagatt
cctttgatcccatccaccccagaagagatgagtgagatgctccagctctgctcctacgtc
cgcttcaaggtgccccagcagatcctgcaaggcctggtcgacgtccgcatccctcataac
aacttctaccgaaagttgtttttggaaatcgtcaacgagaagtcgagatactccctccat
cagaacatggacaagatcaaggttccgacgcagatcatctggggtaaacaagaccaggtg
cttgatgtgtctggggcagacatgttggcaaagtcaatcgccaactgccaggtggaactc
ctggaaaactgtgggcactcggtggtaatggagagacccaggaagacagccaagctcctc
gtcgacttcttagcttctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system