KEGG   Camelus dromedarius (Arabian camel): 105089916Help
Entry
105089916         CDS       T04642                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04012  ErbB signaling pathway
cdk04020  Calcium signaling pathway
cdk04024  cAMP signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04114  Oocyte meiosis
cdk04217  Necroptosis
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04310  Wnt signaling pathway
cdk04360  Axon guidance
cdk04713  Circadian entrainment
cdk04720  Long-term potentiation
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04740  Olfactory transduction
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04911  Insulin secretion
cdk04912  GnRH signaling pathway
cdk04916  Melanogenesis
cdk04921  Oxytocin signaling pathway
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04934  Cushing syndrome
cdk04971  Gastric acid secretion
cdk05031  Amphetamine addiction
cdk05152  Tuberculosis
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05214  Glioma
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105089916 (CAMK2D)
   04310 Wnt signaling pathway
    105089916 (CAMK2D)
   04066 HIF-1 signaling pathway
    105089916 (CAMK2D)
   04020 Calcium signaling pathway
    105089916 (CAMK2D)
   04024 cAMP signaling pathway
    105089916 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105089916 (CAMK2D)
   04217 Necroptosis
    105089916 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105089916 (CAMK2D)
   04922 Glucagon signaling pathway
    105089916 (CAMK2D)
   04912 GnRH signaling pathway
    105089916 (CAMK2D)
   04921 Oxytocin signaling pathway
    105089916 (CAMK2D)
   04916 Melanogenesis
    105089916 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    105089916 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105089916 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    105089916 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    105089916 (CAMK2D)
   04728 Dopaminergic synapse
    105089916 (CAMK2D)
   04720 Long-term potentiation
    105089916 (CAMK2D)
   04722 Neurotrophin signaling pathway
    105089916 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    105089916 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    105089916 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    105089916 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105089916 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089916 (CAMK2D)
   05205 Proteoglycans in cancer
    105089916 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    105089916 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    105089916 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105089916 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105089916 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105089916 (CAMK2D)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     105089916 (CAMK2D)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   105089916 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 105089916
NCBI-ProteinID: XP_010979400
Position
Un
AA seq 523 aa AA seqDB search
MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKKRKSSSSVQMMINNKANVVTSPKENIPTPALE
PQTTVIHNPDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLT
QYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactgcaacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggcattctctgtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcaccagaaactggaaagg
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcggcttcatgacagcata
tcagaagagggcttccattacttggtgtttgatttagtcactggaggtgaactgtttgaa
gacatagtggcgagagaatattacagtgaagccgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcgtggtttggttttgctggcacacctggatat
ctgtctccagaagtcttacgtaaagatccttatggaaagccagtggatatgtgggcatgc
ggagtcattctctatatcctactggttggatacccacccttctgggatgaagaccagcac
agactctatcagcagataaaggccggagcttatgattttccatcaccagagtgggacaca
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaagcgt
atcacagcctcagaggcactgaaacacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaagtttaacgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttctcagcagccaagagtttg
ttgaagaaaccagatggagttaagaaaaggaagtccagttcgagtgttcagatgatgata
aacaacaaagccaacgtggtaaccagccccaaagaaaatattcctaccccggcgctggag
ccccaaactactgtaatccacaaccctgatggaaacaaggagtcaactgagagttcaaat
acaacaattgaggatgaagatgtgaaagcacgaaagcaagagattatcaaagtcactgag
cagctgatcgaagctatcaacaatggggactttgaagcttacacaaaaatctgtgaccca
ggccttactgcttttgaacctgaagctttggggaatttagtggaagggatggactttcat
cgattctactttgaaaatgctttgtccaaaagcaataaaccaatccacaccattatcctg
aacccccacgtacatctggtaggcgatgatgctgcctgtatagcatacattaggctcacc
cagtacatggatggcagcggaatgccaaaaacaatgcagtcagaagagacacgtgtgtgg
caccgccgggatggaaagtggcagaatgttcattttcatcgctcgggatcaccaaccgta
cccatcaagtaa

DBGET integrated database retrieval system