KEGG   Camelus dromedarius (Arabian camel): 105090112Help
Entry
105090112         CDS       T04642                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00561  Glycerolipid metabolism
cdk01100  Metabolic pathways
cdk04714  Thermogenesis
cdk04723  Retrograde endocannabinoid signaling
cdk04923  Regulation of lipolysis in adipocytes
Module
cdk_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    105090112 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    105090112 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    105090112 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    105090112 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cdk01002]
    105090112 (MGLL)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105090112 (MGLL)
Peptidases [BR:cdk01002]
 Serine Peptidases
  Family S33
   105090112 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_5 Abhydrolase_3 Thioesterase PGAP1 DLH Peptidase_S9 LIDHydrolase Chlorophyllase2 Abhydrolase_2 DUF1057 BAAT_C
Motif
Other DBs
NCBI-GeneID: 105090112
NCBI-ProteinID: XP_010979605
Position
Un
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSVPYRELPHLVNADGQYLFCRYWKPSGTPRALVFVSHGAGEHCGRYDE
LARMLVGLGLLVFAHDHVGHGQSEGERMVVSDFQVFIRDVLQHVDLVQKDHPGLPVFLLG
HSMGGAIAILTAADRPGHFSGMILISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPID
SSMLSRNKAEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINTWVSQRTVVAGTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggaaagttctcccagacggaccccgcaaagcgttccctatcgggagctccct
cacctggtgaatgctgacggacagtacctcttctgcaggtactggaaaccctcgggcaca
cccagggccctggtttttgtgtcccatggagccggggagcattgcggccgctatgatgag
ctggctcggatgctggtgggcctggggctgctcgtgtttgcccacgaccacgtcggccac
gggcagagcgagggggagaggatggtcgtgtctgacttccaggtcttcatcagggatgtg
ttgcaacacgtggacctggtgcagaaggaccaccccgggcttccggtcttccttctgggc
cactccatgggaggggccattgccatcctgacggccgcggacaggccgggccacttctcc
ggcatgattctgatttccccgctggttctcgccaaccccgagtccgcaacaaccttcaag
gtccttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggcccgattgac
tccagcatgctctcgcggaataaggcagaggtggacctctacaacacggaccccctcatc
tgccgggcggggctcaaagtgtgctttggcatccagctgctcaacgccgtgtcgcgggtg
gagcgggccctccccaagctgaccctgcccttcctgctgctgcagggctctgccgaccgc
ctgtgcgacagcagaggggcctacctgctcatggagtccgccaagagccaggacaagacg
cttaagatttacgaaggtgcctaccacgtcctccacaaagagcttcctgaagtaaccaac
tctgtcttccgtgagataaacacgtgggtctctcaaaggacagtggtggcgggaacaggg
tccccaccctga

DBGET integrated database retrieval system