KEGG   Camelus dromedarius (Arabian camel): 105090476Help
Entry
105090476         CDS       T04642                                 

Gene name
WNK4
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105090476 (WNK4)
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105090476 (WNK4)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105090476 (WNK4)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  Wnk family
   105090476 (WNK4)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105090476 (WNK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal PKK
Motif
Other DBs
NCBI-GeneID: 105090476
NCBI-ProteinID: XP_010980109
Position
16
AA seq 1231 aa AA seqDB search
MLAPPAPETAVPMSQAEADLALRPPPPPRGAAPLGPPPRRARRFSGKAEPRPRSSRLSRR
SSVDLGLLSSWSQPASPVPEPPDPPDSAGSGPVRSPPPSSEEPPEGTWTGGAPARAADVA
RPELAGSSGGLGSREPPRIPEAAARERRREQEEKEDMETQAVATSPDGRYLKFDIEIGRG
SFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSWKSV
LRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILHRDL
KCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGM
CMLEMATSEYPYSECQNAAQIYRKVTSGTKPNSFYKVKMPEVKEIIEGCIRTDKNERFTI
QDLLAHAFFREERGVHVELAEEDDGEKPDLKLWLRMEDARRGGRPRDNQAIEFLFQLGRD
AAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKAKELEALPPVPGPPPAA
VPMTPGPSSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDPALQ
APRGVPSSPAESHLCLSSAFSLSIPCSGPGNDFSPGDSYASDAASGLSDVGEGMGRMRRP
PGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMVYNE
FILPSERAGFLSRIREIIQRVETLLKRDTGPVEAAEDPLSPQEEPAPLPALPGSLPDPSS
AELQSSTSLEQRSWAAFSTSPSSPGTPSSPGNPFSPGTPVFPSPIFPITSPPCHPSPSSF
SPVSPVSSSLSLQPPSSPLAFSPSASQCPIPSSQFPQSSLLPTCSQVTPIPPTFPPCPSA
PPLPSSTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPGPLPSLPPPTPLAPC
GQERPSPLTAEMESEASPNAGRPLLGEARLAPISEEGKPQLVGRFQVTSSKEPAEPLRLQ
PTSPPLSGSPKPSTPPLTSESSDTEDSAGGGPEAREALAESDRATEGLGAGAEEEGDDGK
ESRVGGSPPPLSHPSPVWMNYSYSSLCLSSEESESSGDDEEFWAELQSLRQKHLSEVEAL
QTLQKQEIEDLYCRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRNSLQRSEPLGPGI
MRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atgctggcacccccggctccagagactgccgtccccatgtcccaggcggaggccgacctg
gccctgcgccccccgcctcccccccgcggggccgccccgctcgggccccctcctcgccgg
gcgcgccgcttctccgggaaggctgagccccggccgcgctcttcccgcctcagccgccgc
agctcagtcgacttgggactgctgagctcttggtctcagccagcctcacccgttccggag
ccccctgatcctccagactcggctggttccggccccgtgaggagcccaccacctagctct
gaagagccccctgagggcacgtggactgggggagccccggcgagggctgcagatgtcgcg
cgtccggagctcgccggctcgtcaggaggcttggggtcccgggaaccaccgaggatcccc
gaagcggcggcccgggagcggcggcgagagcaggaggaaaaggaggacatggagacccag
gctgtggcaacgtccccggacggccgatacctcaagtttgacatcgagattggacgtggc
tcgttcaagacggtgtatcgagggctggacaccgacaccacagtggaggtggcctggtgt
gagctgcagactcggaaactgtcccgagctgagcggcagcgattctcggaggaggtggag
atgctcaaggggctgcaacaccccaatatcgtccgcttctacgactcgtggaagtcggtg
ctgaggggccaggtttgcatagtcctggtcaccgaactcatgacctcgggcacgcttaag
acatacctgaggcggttccgcgagatgaagccgcgagtccttcagcgctggagccgccaa
atccttcgggggctccatttcctacactctcgggtacctcccatcctgcaccgggatctc
aagtgcgacaacgtctttatcacgggccctaccggctccgttaagatcggggacctgggc
ctggccacactcaagcgcgcctcctttgccaagagcgtcatcgggaccccggagttcatg
gctccagagatgtacgaggaaaagtacgatgaggccgtggacgtgtacgcgtttggcatg
tgtatgctggagatggcgacctccgagtatccttactccgagtgccagaatgctgcacaa
atctaccgcaaggtcacttcgggtacaaagccgaacagtttctacaaggtgaagatgccc
gaggtgaaggagatcattgaaggctgcatccgcacggataagaacgagaggttcaccatc
caggaccttctggctcacgccttcttccgcgaggagcgcggcgtccacgtggagctggcg
gaggaggacgacggagagaagcccgacctcaagctctggctgcgcatggaggacgcgcgg
cgagggggacgcccacgggacaaccaggccattgaattcctgttccaactgggccgggat
gcggctgaggaggttgcgcaggagatggtggccctgggcttagtgtgtgaagctgattac
cagccagtggcccgtgcagtgcgtgaacgtgttgctgccatccagcgaaagcgtgagaag
ctgcgcaaagctaaggagttggaggctctccccccagtgccaggacccccaccagcagct
gtccccatgactcctggtccctctagtgtcttcccccctgagcctgaggagccagaggca
gaccagcaccagcccttcctcttccgccatgccagctactcatctaccacctcggattgc
gagactgatggctacctcagctcctccggcttcctggatgcctcagaccctgcccttcag
gcccccaggggggtgccatccagccctgctgagtcccatctctgcctgtcctcggctttt
tccctgtccattccatgttctggtcctggaaatgacttttcccctggagacagctatgcc
tcagatgcagcatcaggccttagtgatgtgggagaagggatgggacggatgaggagaccc
ccagggagaaatctccggcgcagaccccgatcccggcttcgggtcactagtgtctcagac
cagaatgacagagtggttgagtgccagctacagacacacaacagcaagatggtgaccttc
cgatttgatctggatggggacagcccggaagagattgcagctgccatggtgtataacgag
ttcattctgccctcggagcgagctggattcttgagccggattcgggagattatccagcga
gtggagactctgttgaagagagatactggccctgtggaggctgctgaagaccccctgagc
ccccaggaggagccagcaccattgcctgccctcccgggctccctcccagacccatccagt
gcagagctccagagcagcacctccctggagcagaggagctgggcagccttctccacctcc
ccatcctctcctggaaccccctcatctcctggaaaccccttttcccctggaacccctgtc
ttcccaagtcccatcttccccatcacttctcccccatgtcatcctagcccttcctctttc
tccccagtttctcccgtctcctcaagtctctctctacagccccccagctctccacttgca
ttctcccccagtgcatcccagtgtccaatcccatcctctcagtttccacagagttctctc
ctccccacttgttcccaggtcactcctattcctcctacctttcctccctgcccctcagct
cctcccctcccctccagcacagcagcccctctcctctctctggctagtgccttctcactg
gctgtaatgactgtggcccagtccctgctgtccccctcccctgggctcctttctcagtct
cctccagctcctcctggtcccctacctagcctgcctcctccaactccccttgctccttgt
ggccaggagaggccttcacctctgacagctgagatggagagtgaggcctccccaaatgct
ggtcggccacttctgggtgaagccagactggcgcccatctctgaagagggaaagccccag
cttgttgggcgcttccaagtgacttcatccaaggaaccagctgagcctcttcgcctgcaa
ccaacatccccacctctctctggttccccgaagccttcaacccctcccctgacctcggag
agctcagacacagaggatagtgctggaggcgggccagaggccagagaggctctggctgaa
agtgaccgtgcaaccgaaggcctgggggctggagctgaagaggaaggggacgatgggaag
gaatcccgagtagggggcagccctccacccctgagccatcccagcccagtgtggatgaac
tactcctacagcagcctgtgtctgagcagtgaggaatcagagagcagtggggacgatgag
gaattctgggctgagctgcagagtcttcggcagaagcacttgtcagaggtggaggcacta
cagacactacagaaacaggaaatcgaggacttgtactgccggctggggaagcagcccccg
cccggtatcgtggcccccgctgctatgctgtccagccgccagcgccgcctctccaagggc
agtttccccacctcccgccgcaacagcctgcagcgctctgagcccctgggccctggcatc
atgcgaaggaactccctgagtggcagcagcaccggctcccaggagcagcgggcaagcaag
ggggtgacattcgccggggatgttggcaggatgtga

DBGET integrated database retrieval system