KEGG   Camelus dromedarius (Arabian camel): 105090776Help
Entry
105090776         CDS       T04642                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105090776 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105090776 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    105090776 (CPT2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105090776 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 105090776
NCBI-ProteinID: XP_010980426
Position
Un
AA seq 690 aa AA seqDB search
MLRPGTLRAASWVSVRHSFPSSAFSLPPPSGTMVARLLLRAWPRSPAVGRGASCRPLSAG
FEPGQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLDDDQFRKTEQFCKSFA
NGIGKELHEQLVAQDKQNKHTSYISGPWFDMYLAARDPIVLNFNPFVAFNPDPKSEYNDQ
LTRATNMTVSAMRFLKTLRANLLEPEIFHLNPVKSDTDTFKRLIRFVPSSLSWYGAYLVN
AYPLDMSQYFRLFNSTRLPRPSQDELFTDDKARHLLVLRKGHFYVFDVLDQDENIVSASE
IQAHLKYILSDNSLAPEFPLAYLTTENRDIWAELRQKLVSSGNEETLRKVDSAVFCLCLD
DFPIKDLVHLSHNMLHGDGTNRWFDKSFNLIIAKDGTAAVHFEHAWGDGVAVLRFFNEVF
KDSTQAPAVTPQSQPASTDSSVAVQKLHFKLNDALKSGISVAKEKFDATMKTLTIDCIQF
QRGGKEFLKKQKLSPDSVAQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTETIRPASIF
TKRCSEAFVREPSKHSAGELQQMMAQCAKYHSQLTKEAAMGQGFDRHLFALRYLATAKGI
KLPELYLDPAYGRINHNILSTSTLNSPAVNLGGFAPVVSDGFGIGYAVHDNWIGCNVSSY
PGRNAREFLQCVEKALEDMFDALEGKAIKT
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccccggaacactgagggcagcgtcctgggtctctgtacgccacagcttccca
tcctccgcgttctcgctgccgccgccttccgggacgatggtggcccgcctgctgctgcgc
gcctggccccggagccctgccgttggccggggagcctcctgtcggcccctgagtgccggc
ttcgagcccggccagtacctgcagcgcagcatcgtgcccactatgcactaccaggacagt
ctgcccaggctgcctattcccaaacttgaagacaccattaggcgatacctcagtgcacag
aagcctctcttggacgatgaccagttcaggaaaacagaacaattttgtaagagttttgca
aatgggattggaaaagaactgcatgagcagctggtcgctcaggacaagcagaataaacac
acgagctacatctcaggcccctggtttgatatgtacttagctgctcgagaccccattgtc
ctaaactttaacccatttgtggcattcaaccctgacccaaagtctgagtacaatgaccag
ctcacccgggcaaccaacatgactgtttctgccatgcggtttctgaagactcttcgagcg
aaccttttggagccagaaatattccacttgaaccctgtcaaaagtgacactgataccttc
aagagactcatacgctttgtgccttcctctctgtcctggtacggtgcctacttggtcaat
gcatatcccctggatatgtcccagtattttcggcttttcaattcaactcgtttacccaga
cccagtcaagatgagctcttcaccgatgacaaggccaggcacctcctggtcctaagaaaa
ggacatttctatgtctttgatgtcctagatcaagatgagaacattgtgagcgcctctgaa
atccaggctcatctgaagtacattctctcagacaacagcctggcccctgagttcccactg
gcgtacctgaccactgagaatcgggacatctgggcagagctcaggcagaagctggtgagt
agtggcaatgaggagaccctgaggaaagtggactctgctgtgttctgtctctgcctggat
gacttccccattaaggaccttgtccacttgtcccacaacatgctgcatggtgacggcaca
aaccgttggtttgataaatcctttaacctcattatagccaaggacggcactgctgcggtc
cactttgagcatgcttggggcgatggagttgcagtgctcaggttttttaatgaagtattt
aaagacagcactcaggcccctgctgtcactccacagagccagccggccagcactgattct
tctgttgccgtacagaaactccacttcaagctgaatgatgctttaaagtctggcattagt
gttgctaaggaaaagtttgatgccaccatgaaaactctcaccattgactgcatccagttt
cagagaggaggcaaagaattcttgaaaaagcagaagctgagccctgactcagtagctcag
ctggccttccagatggcctttctgcggcagtatgggcagacagtggccacctatgagtcc
tgtagcacagcagcattcaagcatggccgcaccgagaccatccgcccggcctccatcttc
acaaagagatgctctgaggcctttgtcagggagccctccaagcacagcgctggagagctt
cagcagatgatggcccagtgcgccaagtaccacagccagctgaccaaggaagcagcgatg
ggccagggctttgatcgacacttgtttgctctgcggtacttggcaacagccaaagggatc
aaactgccggagctgtacctggaccctgcatacggacggataaaccacaacatcttgtcc
acgagcacgctgaacagcccagcagtgaacctcggcggctttgcgcctgtggtctctgat
ggttttggcattgggtatgctgttcatgacaactggataggctgcaacgtctcctcctac
ccaggccgcaatgcccgggagtttctccagtgtgtggagaaggccttagaagacatgttt
gatgccttagaaggcaaagccatcaaaacttag

DBGET integrated database retrieval system