KEGG   Camelus dromedarius (Arabian camel): 105091987Help
Entry
105091987         CDS       T04642                                 

Gene name
CACNA1I
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04020  Calcium signaling pathway
cdk04713  Circadian entrainment
cdk04925  Aldosterone synthesis and secretion
cdk04927  Cortisol synthesis and secretion
cdk04929  GnRH secretion
cdk04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105091987 (CACNA1I)
   04020 Calcium signaling pathway
    105091987 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    105091987 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    105091987 (CACNA1I)
   04927 Cortisol synthesis and secretion
    105091987 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105091987 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105091987 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cdk04040]
    105091987 (CACNA1I)
Ion channels [BR:cdk04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   105091987 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 105091987
NCBI-ProteinID: XP_031319167
Position
12
AA seq 2301 aa AA seqDB search
MAESSPPPSSPAAAPAAEPGVTEQPGPQSPPPSPPGPEEPLDGVDPDVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDF
IFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAGRQDLNASGLCINWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQAPDPGTPSSAKPGPHA
KEPRHCKLCPRHSPLDPTPHALVQPISAMLASDPASCPRCQHEAGRRPSGLGSSDSGQEG
SGSGGSGGSEDEADGDGARSSEDGTSSDLGKEDEEEQADGAAGLCGDVWRETRAKLRGIV
DSKYFNRGIMMAILVNTVSMGIEHHQQPEELTNILEICNVVFTSMFALEMLLKLAAFGLF
DYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMK
TMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQI
LTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSD
EDQSSSNMEEFDKLQEGLDGGGDPKLCPIPMTPNGHLDPNLPLGGHLAAASAPRFSVQPD
PVLMALDSRKSSVMSLGRVSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKHKPPSA
EHESLLSAERGVGGGTAGGCEGAREEGPPRAAPLHVPHTHHAHHGPHPGHRHRHHRRTLS
LDTRDSVDLAELVPTVGTHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTKMDDRRDRGED
EEEMDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHRLFDYVVLA
FIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRS
SWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVET
LISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVH
HKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFISFLLIV
SFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRL
LIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVMKL
VAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKL
LKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRH
ATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQ
FVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHSLGPGPRPPASSPGAPVPGQGP
GGAGGGGDTEGRLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPA
GCEKCHHDKQEVQLAETEAFSLNSDKSSSILLGDDLSLEDPATCQLGPRDSKGEPDPPEP
MRVGDLGECFFPLSNMAVSSSPENFLCEMEAMPFNPVRSWLKHESSQAPQSPFSTDASSP
LLPMPAEFFHPAVAASQKGQEKGAGARTLPKIALQGSWASLRSPSVNCTLLRQATGSDMS
LEASRSSSAGSLQTTLEDSLTMSDSPRRALGAPAPTPGPHAGLSLGRRRLSLRGXGLFSL
RGLRAHQRSYSSGGSTSPGCTQHDSMDPSDEEGVGGRAGGGGGGAGSEQLGDPRSSASPP
LRAAPAAGLHPRRFQQTSSLAAAPGPPPRRRPAPALARSPPGPPIAARTRRARPSAASRG
PWRRAAAARGEPSSETRRARGREGRRAQRRRAPPPPSARPPRLTFFTSGARGQTAILCPR
PGHRAAGQRQAAAGAGGAGSRCPRLRWPSVVLPVHISIYICIYIERDRHIYIYLFFLLRA
YDFQKVLKLGSVGQSPGRAFA
NT seq 6906 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagctccccgccgccctcctcacctgctgcagccccggcagctgagccagga
gtcacggagcagccagggccccagagcccccctccttcccctccaggccctgaggagccc
ctggatggagtcgatccagacgtccctcacccggatctggcgcctgttgccttcttctgc
ctgcgacagaccaccagcccgcggaactggtgcatcaagatggtgtgtaacccgtggttt
gaatgtgtcagcatgctggtgatcctactgaactgcgtgacactgggcatgtaccagccg
tgcgacgacatggactgcctgtccgaccgctgcaagatcctgcaggtctttgatgacttc
atctttgtcttctttgccatggagatggtgctcaagatggtggccctgggcatttttggc
aagaagtgctaccttggggacacatggaaccgactggatttcttcattgtcatggcgggg
atggtcgagtactccctggaccttcagaacatcaacctgtcagccatccgtactgtgcgt
gtcctgaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctggtgaacctg
ctcctggacacgctgcccatgctgggaaatgtccttctgctctgcttctttgttttcttc
atctttggcatcatcggcgtgcagctctgggcaggcctgctgcgcaaccgctgcttcctg
gaggagaacttcaccatacaaggggatgtggccctgcccccctactaccagccagaggag
gatgacgagatgcccttcatctgctccctgtcgggggacaatggcatcatgggctgccac
gagatccccccgcttaaggagcagggccgtgagtgctgcctgtccaaggacgatgtctat
gacttcggggcggggcgccaggacctcaacgccagcgggctctgcatcaactggaaccgc
tactacaacgtgtgccgcacaggcagcgccaacccccacaagggcgccatcaactttgac
aacatcggctatgcctggatagtcattttccaggtgattactctggaaggctgggtggag
atcatgtactacgtgatggatgctcactccttctacaacttcatctattttatcctgctt
atcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttc
tcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgttacctgtcc
tccagcaccgtggccagctacgccgagcctggcgactgctacgaggagatcttccagtac
gtctgccacatcctgcgcaaggccaagcgccgggccctgggcctctaccaggccctgcag
agccggcgccaggccccggacccggggacacccagctccgccaagcccgggccccacgcc
aaggagcccaggcactgcaagctgtgcccccgacacagccccctggacccgacgccccac
gcgctggtgcagcccatctctgccatgctggcctcggaccctgccagctgcccccgctgc
cagcacgaggcgggccggcggccctcgggcctgggcagcagcgactcgggccaggagggc
tcgggctctgggggctcgggtggcagtgaagatgaggctgacggagacggggcccggagc
agtgaggacgggacctcctcagacctggggaaggaggacgaggaggagcaggcggatggg
gctgccgggctgtgcggagacgtgtggcgggagacgcgagccaagctgcggggcatcgtg
gacagcaagtacttcaaccggggcatcatgatggccatcctcgtcaacaccgtcagcatg
ggcatcgagcaccaccagcagcctgaggagctgaccaacatcctggagatctgcaatgtg
gtcttcaccagcatgtttgccctggagatgctcctgaagctggctgccttcgggcttttc
gactacctgcgcaacccttacaacatctttgacagcatcattgtcatcatcagcatctgg
gagattgtggggcaggcggatggcgggctgtcggtgctgcggaccttccggctgctgcgg
gtgctgaagctggtgcgcttcatgcccgcgctgcggcgccagctcgtggtgctcatgaag
accatggacaacgtggccaccttctgcatgcttctcatgctctttatcttcatcttcagc
atcctcgggatgcacatctttggctgcaaattcagccttcgcacggacacgggagacacg
gtccctgaccggaagaactttgactccctgctgtgggccatcgtcacagtgttccagatc
ctcacccaggaggactggaacgtcgtcctctacaatggcatggcctccacctccccctgg
gcctccctctacttcgttgccctcatgacctttggcaactatgtgctcttcaacctgctg
gtggccatcctggtggagggcttccaggcagagggcgacgccaatcgctcgtactcggac
gaggaccagagttcatccaacatggaggagtttgacaagctccaagagggcctggacggc
ggcggagatcccaagctctgcccaatccccatgactcccaatgggcacctggaccccaat
ctccccctgggtggacatctggctgcagcatctgcccctcgcttctcagtgcagccagac
cccgtgctaatggccctggactcacgcaagagcagtgtcatgtcactggggagggtgagc
tacgaccagcgctccctgtccagctctcggagctcctactacgggccgtggggccgcagt
ggggcctgggccagccgccgctccagctggaacagcctcaagcacaagccaccgtcggcg
gagcacgagtccctgctctccgcggagcgtggcgtcggcggcggcaccgccgggggctgc
gagggtgcccgggaagaggggccgccgcgggccgcgcccctccacgtcccgcacacgcac
cacgcgcatcatggtccccatccggggcaccgtcaccgccaccaccgccggacgctgtcg
cttgacaccagagactcggtggacctggccgagctggtacccaccgtgggcactcacccc
cgggcggcttggagggctgcaggcccggcccccgggcacgaggactgcaatgggaggatg
cctagcatcgccaaggatgtcttcaccaagatggacgaccgccgggatcgcggggaggat
gaggaggagatggactacactctgtgcttccgtgtccgcaagatgattgacgtctacaag
cctgactggtgcgaagtccgtgaagactggtctgtctacctcttctccccggagaacagg
ttccgggtcctgtgtcagaccatcatcgcccacaggctctttgactacgttgtcttggcc
ttcatctttctcaattgcattaccattgccctggagcggccccagattgaggccggcagc
actgaacgcatcttcctcactgtgtccaactacatcttcacagccatcttcgtgggcgag
atgacactaaaggtggtctcgctgggcctgtacttcggcgagcaggcatacttgcgcagc
agctggaatgtgctggacggcttcctcgtctttgtgtcaatcattgacatcgtggtgtca
gtcgcctcggctgggggagccaagatcctgggggtcctccgagtcctgcggctcctgcgc
accctacgacccctgcgtgtcatcagccgggcacctggcctgaagctggtggtagagaca
ctcatctcctccctgaagcccatcggcaacattgtcctcatttgctgtgccttcttcatt
atctttggcatcttgggggtgcagctcttcaagggcaagttctaccactgtctgggtgta
gacacccgcaacatcaccaaccgttccgactgcgtggccgccaactaccgctgggtccat
cacaagtacaacttcgacaatctgggccaggccctgatgtccctctttgtcctggcctcc
aaggatggctgggtgaacatcatgtacaatggactggatgctgtcgctgtggaccagcaa
cccgtgcccaaccacaacccctggatgctgctctacttcatctccttcctgctcatcgtc
agcttcttcgtgctcaacatgttcgtgggcgtcgtggtggagaacttccacaagtgccgg
cagcaccaggaggcggaggaggcgcggcggcgcgaggagaagcggctgcggcgcctggag
aagaagcgccggaaggcccagcggctgccctattatgctacctactgtcccactcggctg
ctcatccactccatgtgcaccagccactacctggacatcttcatcaccttcatcatctgc
ctcaatgtggtcaccatgtccctggagcactacaaccagcccacgtccctggagacagcc
ctcaagtactgcaactacatgttcaccactgtctttgtgctggaggctgtgatgaagctg
gtggcgtttggtctgaggcgcttcttcaaggaccgttggaaccagctggacctggccatc
gtgctgctgtcagtcatgggcatcacgctggaggagatcgagatcaacgcagctctgccc
atcaaccccaccatcatccgcatcatgcgggtcctgcgcattgcccgggtgctgaagctg
ctgaagatggccacggggatgcgggccctgctggacaccgtggtgcaggcgctgccccag
gtgggcaacctgggcctcctcttcatgctgcttttcttcatctatgctgccctgggcgtg
gaactgttcgggaagctggtctgcaacgacgagaacccctgcgagggcatgagccggcat
gccaccttcgagaacttcggcatggccttcctcacgctcttccaggtctccaccggtgac
aactggaacgggatcatgaaggacacgctgcgggactgcacccacgacgagcgcagctgc
ctgagcagcctgcagttcgtgtcgccactgtacttcgtcagcttcgtgctcacggcccag
ttcgtgctcatcaacgtggtggtggccgtgctcatgaagcacctggacgacagcaacaag
gaggcccaggaggacgccgagatggacgccgagctcgagctggagatggcccacagcctg
ggtcctggcccgcggccacctgccagctccccgggggcgcctgtgcccggccaagggcca
ggaggggcgggtggcgggggcgacaccgagggccgcctgtgccgacgctgctattctcca
gcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactccttggagggg
gagctgaccatcatcgacaacctgtctggctccatcttccaccactattcctcgccggcc
ggctgcgagaagtgtcaccacgacaagcaagaggtgcagctggcggagacagaggccttc
tccctgaattcagacaagtcctcgtccatcctactgggtgacgacctgagtctggaggac
cccgcaacctgccagctcggccccagagacagcaagggtgagccagacccacctgagccc
atgcgtgtaggggacctcggcgaatgcttcttccccttgtccaacatggctgtctcgtcg
agtccagagaacttcctgtgcgagatggaggcgatgccgttcaaccctgtccggtcctgg
ctgaaacatgagagcagccaagcgccccagagccccttctccacggatgcttccagcccg
ctcctgcccatgccagccgagttcttccaccctgctgtggctgccagccagaaagggcag
gagaagggcgctggtgccaggaccctccccaagatcgccctgcagggctcctgggcatcc
ctgcggtcgcctagtgtcaactgcaccctcctccggcaggccacagggagcgacatgtcg
ctggaggccagccgcagcagctctgcaggcagcctgcagaccacgctggaggatagcctg
accatgagcgacagtccgcggcgcgccctgggcgctcctgcgcccaccccggggccccac
gctggcctgtcgctcggccgccgccgcctgagcctgcggggcncgggcctgttcagcctg
cgcgggctgcgggcgcaccagcgcagctacagcagcgggggctccaccagcccgggctgc
acccagcacgattccatggacccctcggacgaggagggtgtgggcggccgggccggcggg
ggcggcgggggcgcgggcagcgagcaactcggagaccctcgcagctctgcgtcacctcct
cttcgggccgcgcccgccgccgggctccacccccgccggtttcagcagaccagcagcctg
gccgccgcccccggtccgcccccgcgccgccgcccggccccggccctggcccgcagcccc
cctgggccgccgatcgctgcaaggacccgccgcgccaggccgagcgccgccagccggggc
ccttggcgccgggccgcagccgcccggggggagccgagctcggagacgcggcgagccagg
ggaagagagggccgccgggcccaacgccgccgcgcgccgccgccgccctccgcccgcccg
ccccgtctcaccttctttacctcaggagccagggggcagacagcaatactttgtccacga
cctgggcaccgcgccgcgggccagcgccaggccgccgccggggcgggtggagcagggtcc
cggtgcccgaggctcagatggcccagtgtggtcctgcccgtgcatataagtatatacata
tgcatatacatagagagagacagacatatatatatatatttattttttttactgagagct
tatgacttccagaaagtgctaaagttggggagtgtgggtcagagcccaggcagggctttt
gcctga

DBGET integrated database retrieval system