KEGG   Camelus dromedarius (Arabian camel): 105092363Help
Entry
105092363         CDS       T04642                                 

Gene name
EPCAM
Definition
(RefSeq) epithelial cell adhesion molecule
  KO
K06737  epithelial cell adhesion molecule
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105092363 (EPCAM)
   04090 CD molecules [BR:cdk04090]
    105092363 (EPCAM)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   105092363 (EPCAM)
  Exosomal proteins of colorectal cancer cells
   105092363 (EPCAM)
CD molecules [BR:cdk04090]
 Proteins
  105092363 (EPCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpCAM_N Thyroglobulin_1 DUF3551 DAG1 Podoplanin ASFV_J13L
Motif
Other DBs
NCBI-GeneID: 105092363
NCBI-ProteinID: XP_031322826
Position
15
AA seq 314 aa AA seqDB search
MAPPQVLAFGLLLAAATAAVAAAKEECVCENYKLTTNCSLNAYGQCQCTSLGTQNSVICS
KLATKCLVMKAEMTGSKDGRREKPEGAIQNNDGLYNPDCDEKGLFKAKQCNGTSTCWCVN
TAGVRRTDKDSEISCSERVRTYWIIIELKHKAREKPYDVQSLQTALKEVITSRYQLDPKY
ITNILYENDVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKDESLFYSKRMDLKVNGELL
DLDPGRTSIYYVDEKPPEFSMQGLQAGIIAVIVVVAIAIIAGIVVLVISRKKRMAKYEKA
EIKEMGEMHRELNA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccccccaggtcctcgcgttcgggctcctgctcgcggcagcgacggcagcggtg
gccgcggccaaagaagaatgtgtatgtgaaaactacaaactgaccacaaactgctctttg
aacgcgtatggtcagtgccagtgtacttcacttggtacacaaaattccgtcatttgctca
aaattggctaccaaatgtctggtgatgaaggcagaaatgactggctcaaaggatgggaga
agagagaaaccagagggtgctatccagaataatgacggtctctacaatcccgactgtgat
gagaaggggctctttaaagccaagcagtgcaatggcacctccacgtgctggtgtgtgaac
actgccggggtcagaagaaccgataaggacagtgaaatatcctgctccgagcgagtgagg
acctactggatcatcattgaactaaaacacaaagcaagagaaaaaccttatgatgttcaa
agtttgcaaactgcactcaaagaggtaatcacaagtcgttatcagctggatccaaaatat
atcacaaatattctgtatgagaatgatgttatcactattgatctagtacagaattcttct
cagaaaactcagaatgatgtagacatagctgatgtggcttactattttgaaaaagatgtt
aaagatgaatccttgttttattccaaaaggatggacctgaaagtaaatggggaactactg
gatctggatcctggtcgaacttcaatttactatgttgatgaaaaaccacctgaattttca
atgcagggtctacaagctggtattattgctgtcattgtggttgtggcaatagcaattatt
gccggaattgtggtgctggttatttccagaaagaaaagaatggcaaagtatgagaaagct
gagataaaggagatgggtgagatgcacagggaactcaatgcataa

DBGET integrated database retrieval system