KEGG   Camelus dromedarius (Arabian camel): 105093121Help
Entry
105093121         CDS       T04642                                 

Gene name
FANCD2
Definition
(RefSeq) Fanconi anemia group D2 protein isoform X1
  KO
K10891  fanconi anemia group D2 protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    105093121 (FANCD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cdk03400]
    105093121 (FANCD2)
DNA repair and recombination proteins [BR:cdk03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     105093121 (FANCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 STN
Motif
Other DBs
NCBI-GeneID: 105093121
NCBI-ProteinID: XP_031326705
Position
17
AA seq 1449 aa AA seqDB search
MASKRRLSRSGDKESLTEDTSKARKQPLSKKTKESYVHNEVEENASVFVKLLKTSGITLK
TGESQNQLAVDQIVFQKKLFQTLRKHPSYPKIIEEFVSGLESYIEDRDSFRNCLLSCERV
QDEESSMGTSYCKSLIKLLLGIDILQPAIIKTLFEKLPEFLFEKVNSDGINMPRLIINQL
KWLDRVVDSKDLTTKIMQLISIAPLDLQHDFVTSLPEILGDSQNAEVGKELIDLLTENTL
LTVPILDVLSSLQLDPKLLTKVRQLVMSKLSSVTLDDLPVIVKFILHSITIVDAFEVIAE
LREELDLQHCILPSLFQASQSKLKTKGQTSSSGIQENSDKDCVTLLFDVIKSAVRYERVI
PEAWIKAIESTASASEHKTFDLAVLLIIYSTNAQTKKYVERVLRSKIRSGCFQEQLLQGT
FCVHYLVLKDVCPSILSLAQTLLHSSHQSIILFGSLLYKYAFKFFDTYCQQEVIGALVTH
ICSGNEAEVDIALDVLLELVVLNPSAMRLNAVFVKGILDYLDNMLPQQIRKLFYTLSILA
FSKQHEANNHIQDDLHLVIRKQLSSTIFKYKLIGIIGAVTMAGIMATDRSRFFSLTPGRG
DLSDEQCTQVTSLLQLVHSCSKQSPQASAVYYDEFANLIQEEKLAPKALEWVGQTIFHEF
QDAFVVDSCVVPEGDCPFPVKALYGLEDYSSDGIAVNLLPLLFSQDFAKDGGSPTSQASD
QKLVSPLCLAPYFRLLRLCVERQHDGNLEEIDGLLDCPIFLTDLEPGERLQSMSIKERSF
MCSLIFLTLNWFREVVNAFCRQTLPEVKAKVLTRLKNIVELQQILEKHLAVTPDYVPPLA
NFDLEGLEVTPPTNTAVSSKIRMQGKIGGRKRKADGSKMPSPDAPSKEDNSECDPAPSDR
SQVEKELKGKEGKTSVSLQNYHAYFRELDIEVFSILHCGLVAKFILDAEMHTEATEVLQL
QPPELLFLLEDLSQKLENMLTPSIARRVPFLKSKGNRNVGFSHLHQRSALEIAFRVVQLL
TPLCKYLENIHNYFQSLDAENCGVAVGPGMEVEEYHVMASCYQRLLQIFHGLFAWSGFFE
LQNYNLLYSALKVLNSRLKQVEPDQALDELLSQSFHYLQNFHLSIPNFQCALYLIRILMV
LSEKSTAPTQNKEKIASLARQFLCRVWPSGEKEKNSVPNDQLQALLSIYLEHTDNVLKVI
EEIAGVGVPELISSPKEACSSTFPTLTRHTFVIFFRVMMAELEKTVNDLQTGTAADSQQV
HEQKLLYWNMAVRDFSILINLIKVFDSRPVLHACLKFGRLFVEAFLKQCMPLLDFSFRKH
REDVLSLLETFQLSTRLLHHLCGHSKIHQDMKLTKHVPFLKKTLELLVCRVKAMLIFNNC
REAFWLGNLKNRDLQGEEIISQSSQESTADENEDDTSSQASKSKATEDGEEDEASDGEEE
SDDSDDDSD
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagaaggctgtcaagatctggggataaagagagcctgacagaagatacc
tccaaagccaggaagcaaccactttccaaaaagacaaaggaatcttacgttcataatgaa
gttgaagaaaatgccagtgtctttgtaaagcttcttaaaacatcaggaattactcttaaa
acaggagagagtcagaatcaactagccgtggatcaaatcgttttccaaaagaagctcttt
cagactctgaggaaacatccttcttatcccaaaataatagaagaatttgttagtggcctg
gagtcttacattgaggaccgagacagtttcaggaactgccttctgtcttgtgaacgtgtg
caggatgaggaatccagcatgggtacatcttactgtaagagcctcattaaattgcttctg
ggaatcgacatactgcagcctgccattatcaaaaccttatttgaaaagttgccggaattt
ctgtttgaaaaggtgaacagtgatggaatcaacatgcctcgactcatcatcaatcaactg
aaatggctagacagagttgtggacagtaaggatctcaccaccaagatcatgcagctgatc
agtatagcgccattggacctacagcatgacttcgtcaccagcctacctgagatccttggg
gattcccagaatgctgaagtggggaaagaactcattgaccttctaacagagaatactctg
ctcactgtcccgatcctggatgttctttccagcctccagcttgacccaaagctgctgact
aaggtccgccagttggtgatgagtaagctgtcatctgtcacattggacgatttacctgtg
atagtcaagttcattcttcattctataacaattgtggatgcatttgaggtaattgctgag
cttcgggaggagttggatctgcagcattgtattttgccttcattgtttcaggcttctcaa
agcaagttgaaaactaaaggccaaacaagttcttcaggaattcaagaaaacagtgacaag
gactgtgttactctcctctttgatgtgataaagtcagctgttagatatgagagagttatt
ccagaagcctggattaaggcaattgaaagcactgcctccgcatctgaacacaagactttt
gacctggcagtgcttctcatcatctacagcaccaacgctcagacaaagaagtacgttgag
agggtgctaagaagtaagattcggtcaggctgctttcaggaacagctgctgcagggcacg
ttctgtgttcattacttggttcttaaggatgtttgtccatccattttgtcgctggctcag
actttgttgcactcctcacaccagagcataattttgtttggcagtctcctgtacaaatat
gcatttaagttttttgacacttactgccagcaggaagtgattggtgccctggtgacccat
atctgcagtgggaacgaagccgaggttgatattgcgttggatgtcctcctagagttggta
gttctgaacccatctgctatgagactgaatgctgtctttgtgaagggtattctagattat
ctggataatatgttgcctcagcagatacgaaaactcttctatacgctcagcatactggca
tttagcaaacagcatgaagccaacaatcacatccaggatgaccttcatctggtgatacga
aaacagctctctagcactatattcaagtacaaactcattggtattattggcgctgtcacc
atggctggcatcatggcgacagacagaagcagatttttcagtttgaccccagggagagga
gacctgagcgatgaacagtgcacacaggtgacctccttgctgcagttggttcattcgtgc
agtaagcagtctcctcaggcctctgcagtttattatgatgagtttgccaacctaatccag
gaagaaaagctggctccaaaagccctggaatgggttgggcagaccatctttcatgagttc
caggatgcctttgtggtggacagctgtgttgttccagaaggtgactgcccatttcccgtg
aaagctctctacggactggaagactacagtagtgatgggattgccgtcaacctcctgcca
ctcttgttctcgcaggactttgcaaaagatgggggtagcccaacttcgcaggcatcagac
caaaagttggtttctccattgtgcctggctccctatttccggttactgagactgtgtgtg
gagagacaacatgatggaaacttggaggagattgatggtttattagattgtcccatattc
ctcactgacctggagcctggagagagactgcaatccatgtctatcaaagagcgttcattc
atgtgttcactcatatttcttactctcaactggttccgagaggttgtaaatgccttctgt
cggcagacgttgcctgaggtgaaggcgaaggtgctcacccggttaaagaacatcgttgag
ctgcagcagatcctggaaaagcacctggcagtcactccagactatgttcctccccttgca
aattttgacttggaaggtttagaagtaacacctcctaccaatactgctgtttcctcaaaa
atcagaatgcaaggaaagataggaggaaggaaacgaaaagcagatggcagcaaaatgccc
tccccggacgcaccttcaaaagaggacaattcggagtgcgaccctgcgccgtctgacagg
agccaggtggaaaaggagctcaaagggaaagaaggaaagacatcagtgtcgctacagaat
taccacgcttatttccgagagctggacattgaggtcttctctattctgcattgtgggctt
gtggccaagttcatcttagatgctgaaatgcacactgaagctacagaagttctgcagctt
cagcctcctgagctgcttttcttgctggaagacctctcccagaagctggagaatatgctg
acaccttctattgccaggagagtccccttcctcaagagtaaaggaaaccggaatgttgga
ttctcacatctccatcagagatcggccttagaaattgcttttagagttgttcagctgctg
accccgctgtgtaaatatctggagaacatacacaactattttcagagcttagatgctgag
aattgtggtgtagctgttggaccgggaatggaagttgaggagtaccacgtgatggcgtcc
tgctatcagaggctactgcagatttttcatgggctctttgcttggagtggattttttgaa
cttcaaaattataatttactgtactcagccctcaaagtccttaatagtcgactgaagcag
gtagagcctgaccaagccttggacgaactgctcagccagagcttccattacttgcagaat
ttccatctcagcattcccaatttccagtgtgctctttatctcatcagaattttgatggtc
ctttcggaaaaatctacagctcctactcagaacaaagaaaaaattgcttccctggccaga
cagttcctctgtcgggtgtggccaagtggggagaaagagaagaacagcgtccctaatgac
cagctccaggctttgcttagcatctacctggagcacacagacaatgttctgaaggtcata
gaggagattgctggtgttggtgtcccagaactgatcagctcccctaaagaggcatgttcc
tccacgttccctacactgaccaggcacacctttgtcattttcttccgtgtgatgatggct
gaactagagaagacagtgaacgatcttcagactggaacagcggcagactcacagcaggtt
cacgaacagaagctcctctactggaacatggctgttcgagacttcagcatcctcatcaac
ctgataaaggtgtttgatagccgtcctgttctgcacgcgtgtttgaagtttgggcgtctg
tttgtggaagcattcctgaagcagtgtatgccgctcctagacttcagttttagaaaacac
cgggaagatgttctgagtttactggaaaccttccagttgagcacaaggctgcttcatcac
ctgtgtgggcattccaagattcaccaggacatgaaactcaccaaacatgtgcctttcctc
aaaaagaccctggagctgttggtttgcagagtgaaagccatgctcatcttcaacaactgc
agagaggctttctggctgggcaacctgaaaaaccgggacttgcagggtgaagagattata
tcccagagttcccaggagagcacagcagatgagaatgaggacgatacctcatcccaggcc
tccaagagcaaagcaacagaggatggtgaagaagatgaagcaagtgatggagaagaggag
agtgatgacagtgatgatgactctgattag

DBGET integrated database retrieval system