KEGG   Camelus dromedarius (Arabian camel): 105095149Help
Entry
105095149         CDS       T04642                                 

Gene name
GEMIN5
Definition
(RefSeq) gem nuclear organelle associated protein 5
  KO
K13133  gem associated protein 5
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03013  RNA transport
Module
cdk_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105095149 (GEMIN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105095149 (GEMIN5)
   03041 Spliceosome [BR:cdk03041]
    105095149 (GEMIN5)
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     105095149 (GEMIN5)
   mRNA cycle factors
    P-body specific factors
     105095149 (GEMIN5)
Spliceosome [BR:cdk03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    105095149 (GEMIN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 105095149
NCBI-ProteinID: XP_010985560
Position
Un
AA seq 1510 aa AA seqDB search
MGQEPRVLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGADAIPGTPPFRVIGEL
VGHTERVSGFTFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISALHWSPR
VKDLIVSGDEKGVVFCYWLNRNDSQHLFIEPRTILCLTCSPHHEDLIAIGYKDGIVVIID
ISKKGEVIHRLRGHDDEIHSIAWCPLPGEDCLSINQEENSEEPEIPNGKVIAQTPVAKGC
YLATGSKDQTIRIWSCSRGRGVMMLKLPSLKRRGGGIDPTVKERLWLTLHWPKDQPTQLV
SSCFGGELLLWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRD
VKCWDMATLECCWTLPSLGGFAYSLAFSPVDTGCLAIGVGDGMIRIWNTLSIKNNYDVKN
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSSKPPQISSTYHKKTVYTLAWGP
PVPPTALGGEGDRPSLTLYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSITYKLPVHT
EISWKADGKIMALGNEDGSIEIFRVPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLM
ASGSNNAVIYVHNLQTVIESNSESPVTITEPYRTLSGHTAKITSLAWSPHHDGRLVSASY
DGTAQVWDTLQEEPLCNFRGHRGRLFCVVWSPLDPDCIYSGADDFCVYKWLTSMQEHSRP
PQGKKSIELEKKRLSQPKPKPKKKKKPTSRVPIKQELCDRNEDEGVKESSGPVENGVSDQ
ETEEEAREPELPCAVTSAVSKEPISCTPVSVGFEKSKVTINNKVTLLKKELPKEKSEALM
KKRKARSILPLSTSLDHRSKEEIHQDCLVLATAKHSKAEPNEDVSADLEERFHLGLFTDR
ATLYRMIEVEGKGHLENGHPELFHQLMLWKGDLKGVLRTAAERGELTDNLVAMAPVAGYH
VWVWAVEAFAKQLCFQDQYVKAASHLLSIHKVYEAVELLKSNHFYREAIAVAKARLRPED
PILKDLYLSWGAVLEKDGHYALAAKCYLGATSAYDAAKVLSKKGDATSLRTAAELASIVG
ENELSASLALRCAQELLLARNWVGAQEALHLHESLKGQRLVFCLLELLSKHLEEKQLLEV
KSSSSYNAWTAGGEGPFVERVTAVWKTAFSLDSPEQYQAAVRQLQSVKYPSATSNTPSKQ
LLLHLCHDLTLAVLSQQVASWDTAVEELLRAVMRSYDSGNFTIMQEVHSAFLPEGCDHLR
DKLGDHQSPTTPAFKSLEAFFIYGRLYEFWWSLSGPCPESSIWVRAAHRRMTSVEQSQQL
NNVSPEETEPKASQPEPSRPPELDVRLTEEGEQILRACKELFSEEHASLQNSQRTVAEVQ
ETLADMIRQHQKRQLCKPTADGPAKNEPEQEAEQSLSGSQHQCKEEKSEPVSLPELTKRL
TEANERIAKFPESIKTWPFPDVLECCLILLHIKSQHPGCVTHEMQQQAQELLQKYSNTKV
YKRHCQTFCT
NT seq 4533 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggagccgcgtgtgctgccgccctcccctaactggtactgtgcccgatgcagc
gatgcagtgcccgggggcctcttcggtttcgccgcgcggacctccgtcttccttgtccgc
gtgggcccgggcgcggacgcgatcccggggacgcccccatttcgagtcataggggagttg
gtgggacacaccgaaagggtctctggcttcaccttttctcatcacccgggtcaatacaac
ctctgcgccaccagctcggacgacgggactgtgaaaatctgggatgtagagacaaaaaca
gttgtaacggaacatgcactccatcagcatacaatatcagcattgcattggtctcctcga
gtaaaggatttaatagtatctggagatgaaaagggagtagttttctgttactggcttaac
agaaatgacagccagcacctctttattgaacccaggacaattttatgtcttacttgctca
cctcatcatgaagatttaatagccattggctacaaggatggcatagtggttataattgac
atcagtaagaaaggagaagttattcacaggcttcgaggccatgatgatgagatccactcc
atagcctggtgtcccctgcctggtgaagattgtttatccataaatcaagaggaaaattca
gaagaacctgaaattcccaatgggaaagttatagcacaaactccagtagcaaaaggctgc
tatttagccactggaagcaaagaccagaccattcgaatctggagctgctctagaggccga
ggggtgatgatgttgaaattgccctctctaaagagaagaggagggggtatagacccaact
gttaaggagcgcctttggttgacactccattggcccaaggatcagccaacacagctggta
tccagctgttttggaggtgaactgctgctctgggatctcactcagtcttggagacggaaa
tataccctcttcagcgcttcatcagaagggcaaaatcattcaagaattgtgtttaattta
tgtcctctacaaaccgaggatgacaaacagctgctgctttccacgtcaatggacagagat
gtaaaatgttgggacatggccaccctagagtgctgctggaccctgccttcccttggaggg
tttgcctacagtctggctttctctcctgtggacacaggctgtttggccataggcgttggg
gatggcatgatccgcatctggaatacactctccataaagaacaactatgatgtgaaaaat
ttttggcagggtgtcaagtccaaggttacagcgctgtgctggcacccaaccaaggaaggc
tgcttagcttttggaactgacgatggaaaagtgggattgtacgacacctactccagcaaa
cctccacagatttctagcacatatcataagaagactgtgtacacattagcctgggggcca
cctgtaccccctacagcactcggaggagaaggagacagaccatcactcaccttatacagc
tgtggaggagaggggattgtcttacagcacaacccctggaaactcagtggagaggccttt
gacatcaacaaactcatcagggacaccaattcaatcacatacaaattgccagtacacaca
gagatcagctggaaagcagatggcaaaatcatggctcttggcaatgaagatggatcaata
gaaatattcagggttcctaacttgaaactgatctgcaccatccagcagcatcacaagctt
gtgaatactattagctggcatcatgagcacggcagccagccagagctgagctatctgatg
gcctctgggtccaacaatgcagtcatttatgtgcacaacctgcagactgtcatagagagc
aattctgaatctccggtgaccattacagagccctaccggaccctctcagggcacacagcc
aagattaccagtctggcatggagcccacatcatgatggaaggctggtatctgcttcctat
gatggtacagctcaggtgtgggatactctccaggaagagcctctatgcaatttccgagga
catcgaggtcgactgttttgtgtggtgtggtccccactggatccagactgcatctactca
ggggcagatgacttctgtgtgtacaaatggctcacttccatgcaagaacattcccggcct
cctcaaggcaagaaaagtattgaattagagaaaaaaaggctctctcagcctaagccaaaa
ccaaaaaagaagaaaaagcccacctcgagagtgcctataaagcaggaattgtgtgaccgg
aatgaagacgagggcgtgaaagagagctcgggccctgttgagaacggcgtgtcggaccag
gagaccgaggaggaagcccgggagccagagctaccctgtgctgtcacctcagccgtttct
aaagaaccaattagctgcactccagtttctgtaggttttgaaaagtcaaaagtcaccatt
aataacaaagtcactttactgaaaaaggagctacctaaagagaagtcagaagccttaatg
aagaagcgaaaagctcgttccatccttccactgagtacgagcctggaccacagatccaaa
gaggagattcatcaggactgtttggtgttagccactgcaaaacactccaaagcagagcca
aatgaggatgtgtctgctgatcttgaggaaagatttcacctggggctgttcacagacagg
gctaccctgtacagaatgattgaagttgaaggaaaggggcacttggaaaatggccaccct
gagttatttcaccagctcatgctttggaaaggagatctaaaaggtgttctccggactgca
gcagagagaggagagctgacagacaatctagtggctatggcaccagtggctggttaccat
gtgtgggtatgggctgtggaggcttttgccaaacagctgtgtttccaggaccagtatgtc
aaggctgcctctcacctgctttctatccacaaagtgtacgaagctgtggagctgctcaag
tcaaaccatttctacagggaggctattgcagttgccaaggcccggctgcgcccagaggac
ccgatcctgaaagacctgtacctcagctggggggccgtcctagaaaaagatggccattat
gctttagcagccaaatgctatttaggggccacttcagcttatgatgcagccaaagttttg
tcaaaaaagggggacgcgacatcacttagaactgctgcagagctggcttcaattgtagga
gagaatgagttgtctgcttccctggctctcagatgtgcccaagagctgcttctggccagg
aactgggtgggagcccaggaagccctgcaccttcacgaaagtctaaagggtcagagactg
gtgttttgccttcttgagctactgtccaagcacctggaggaaaagcagcttttggaggtc
aaaagttcctcttcttacaatgcttggaccgcaggcggcgaagggcccttcgtggagaga
gtgactgcggtgtggaagacagccttcagcctcgactccccagagcagtatcaggcagca
gttcggcaactgcagagtgtcaagtacccctctgctacaagtaacactccctccaaacag
ctcctgcttcacctttgccatgacctgaccctggcagtgctgagccagcaggtggcctcc
tgggacacagctgtggaagaactgcttcgggctgtaatgcggagctacgactcaggaaat
ttcaccatcatgcaggaagtgcactcagcctttcttcctgagggctgtgaccaccttaga
gacaaactgggtgaccatcagtcccccaccacaccagccttcaaaagtttggaggctttt
tttatttacggacgtctgtatgaattctggtggtctctctccgggccttgccctgaatcc
agcatctgggtaagggctgctcacagaaggatgacttctgttgagcaaagccagcagctg
aacaatgtcagccctgaagaaactgagcccaaagcttctcagccagagccaagcaggcct
ccagaactagacgtgagactcacagaagaaggtgagcaaatactgagagcttgtaaggag
ctcttttcagaagagcatgccagtctccaaaattcacagagaactgttgctgaagtccaa
gaaaccctggcagacatgatccgccaacaccagaagagacaactctgcaaacctacggca
gatggtcctgctaagaatgaacctgaacaggaagcagaacagtccctctctggttctcag
caccagtgtaaagaagaaaaaagtgagccagtttctttgcctgaattaaccaaaaggctt
acagaagcgaatgagagaatagctaagtttcctgagagtattaagacctggcccttccca
gatgtgctggagtgctgcctcatcctgcttcacatcaagtctcaacatcctggctgtgtg
acgcacgaaatgcagcaacaggctcaagagctccttcaaaaatacagcaacactaaagtt
tacaaaagacactgccagaccttctgcacatga

DBGET integrated database retrieval system