KEGG   Camelus dromedarius (Arabian camel): 105095876Help
Entry
105095876         CDS       T04642                                 

Gene name
AOAH
Definition
(RefSeq) acyloxyacyl hydrolase
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105095876 (AOAH)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     105095876 (AOAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL SapB_2 Cu-binding_MopE Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 105095876
NCBI-ProteinID: XP_010986389
Position
Un
AA seq 574 aa AA seqDB search
MKSPWKILMAAPVFFLLNLHTSASPAYDDHPSRHSKSHACIGCVLVVSVVEQLAQVHNST
VQTSMERLCSYLPEKLFLKTTCYLVVRIFGPDIIKLLSADMNADVVCHTLEFCKQDPGQP
LCHLYPLPKEPWKFTLETARQIVKKSPTLTYSRSRSDICSLPFLAKICQKIKSAIQNSVP
SQDVDSDKYSVFPTLRGYHWRGRDCNDRNKTVYPGRRPDNWDAHQDSNCNGIWGVDPKDG
IPYEKKFCEGSQPRGIILLGDSAGAHFHIAPEWITASQMSLKSFFNLPTALTDELNWPQL
SGATGFLNSTRGIKEDSIYLRLWKRNHCNHRDYQNISRNGASSQNLKRFIESLSRNQLLD
QPAIVIYAMIGNDVCSGNRDPVPEMTTPEKLYSSVMQTLQHLNSHLPNGSHVILYGLPDG
TFLWDNLHNRYHPLGQLNQDVTYAHFYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLS
VTLKKIATSKKFMNFNLFYMDFDFQEITEEWRKRGGQPWQLIEPVDGFHPNEVALQLVAD
HFWKKVQLQWPQILGKENPFNPQIEQVFGDQGGH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctccctggaaaatccttatggcggctcctgtgttctttcttctgaaccttcac
acctcagcctccccagcctatgatgaccaccccagcagacattccaaaagccatgcctgt
atagggtgtgtgctggtggtatccgtggttgaacagcttgctcaagttcacaactcaacg
gtccagacctcgatggagagactgtgcagctacttgcctgaaaaattgttcttgaagacc
acctgctatttagtggtacgcatatttggaccagacatcataaaactgcttagcgcagat
atgaatgccgatgttgtgtgtcacaccctggagttttgtaaacaggaccctggccagccg
ttgtgtcacctctatccccttcccaaggagccatggaaatttacactagagacagcaaga
cagattgtcaagaaatccccaactctgacatattcccgaagtcgttctgatatttgttca
ctcccgtttttggccaagatctgtcagaagattaaatcagctatacaaaattctgtgcca
tcccaagatgtagattcagacaaatacagtgttttcccaacactgcggggctatcactgg
cgagggagagactgtaatgacagaaacaagacggtgtacccgggtagaaggccagacaat
tgggatgcacatcaggattccaactgtaatggcatttggggtgttgatccaaaagatgga
attccatatgagaagaaattctgtgaaggttcacagcccaggggaatcattttgctggga
gactcggctggggctcattttcacatcgctcccgaatggatcacagcttcgcagatgtct
ttgaaatccttcttcaatttaccaacagctcttacggatgagctcaactggccccaactc
tccggtgctactggatttctgaactccactcgtggaattaaagaagactctatttacctt
cgtttatggaaaagaaaccactgcaatcacagggactaccagaatatttccagaaatggg
gcatcatcccaaaacctgaagagattcatagaaagtttgtctaggaaccagctgttggac
cagccagccattgtcatctatgccatgattggaaacgatgtctgcagtgggaatagggac
ccagtcccagaaatgaccactcctgagaaactgtactccagcgtcatgcagactctgcag
catctaaactcccacctgcccaacggcagccatgttattttatacggtttaccagatgga
acctttctctgggataatttgcacaacagatatcatcctctcggccagctcaatcaggac
gtgacctacgcgcatttctactccttcctcaactgtctccaggtcagcccctgccacggc
tggatgtcttccaacaagacgctccggactctcacttcagagagagcagaacaactctcc
gttacgctgaaaaaaattgcaaccagcaagaaatttatgaacttcaatcttttctacatg
gattttgacttccaagaaatcacggaggagtggcggaagagaggcgggcagccctggcag
ctcatcgaacccgttgatggattccaccccaatgaggtggctttacagctggtggcagat
cacttctggaaaaaggtgcagctccagtggccccagatcctgggaaaggagaacccgttc
aacccgcagattgagcaggtgttcggagaccaaggggggcactga

DBGET integrated database retrieval system