KEGG   Camelus dromedarius (Arabian camel): 105096413Help
Entry
105096413         CDS       T04642                                 

Gene name
MTMR6
Definition
(RefSeq) myotubularin related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00562  Inositol phosphate metabolism
cdk01100  Metabolic pathways
cdk04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105096413 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105096413 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105096413 (MTMR6)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     105096413 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     105096413 (MTMR6)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    105096413 (MTMR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase DSPc Y_phosphatase3 Rtt106 DivIC FlxA
Motif
Other DBs
NCBI-GeneID: 105096413
NCBI-ProteinID: XP_010987054
Position
Un
AA seq 621 aa AA seqDB search
MEHIRTTKVEQVKLLDRFSSSNKALTGTLYLTATHLLFIDFHQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLRGWQLIDLAEEYQRMGVPNSNWQLSDANRDYKICETYPKELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQSKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPANHYMYVVDTR
PRLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQRLLEVSGTRGLSVGDLYS
GLQSSGWLRHVQAVLGAAVVLAKAVTTESASVLVHCSDGWDRTSQVCSLGSLLLDPYYRT
VRGFMVLIEKDWISFGHKFSERCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFNEA
FLLQIHEHIHSCQFGNFIGNCQKEREELKLKEKTYSLWPFLLEDRVKYLNPLYQPQAQEF
AVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIANMNEQNKQLENDIKDLESQIKQC
KNKQADGVLTKELLNSVRPESPTLKTSLCFKEQTLLPGNDALRTIDSSNPADNRYSEYAE
EFSKPDPAVVSLEYGVARMTC
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccgtacgaccaaggttgagcaagtgaaattacttgaccgattcagtagc
agcaacaaggctctgacagggaccctgtacctcacggccacacatctgttgttcatagac
tttcaccagaaagaaacctggatcttgcaccaccacattgcctcggtggagaagctggct
ctgacgacgtcggggtgcccactggtgattcagtgcaagaacttccggactgtgcatttc
atcgttcccagagaaagagattgccacgacatctacaactctctgctacagctgtcaaag
caagcaaaatatgaagacctctacgcattctcttataaccccaaacaaaacgattcagaa
agactgcgaggctggcagctcattgaccttgcggaggagtatcagaggatgggggtgccg
aattcaaactggcagctgtctgacgccaacagggactacaagatttgcgaaacttacccc
aaagaactttatgttccccgaatagcaagcaagccaataattgttggtagttccaagttc
cggagcaaggggcggttccccgttctttcctactatcatcagagtaaggaggctgccatt
tgtcgatgtagtcagccactgtcaggattcagtgcccggtgcctggaggacgagcatttg
cttcaggccatcagcaaagccaacccagccaaccactacatgtacgtcgtggacaccagg
ccccggctgaatgccatggccaacagagcagctggaaaaggttatgaaaatgaagacaac
tactctaatattaggtttcagtttgttgggattgaaaatattcacgtcatgcggtccagc
cttcagagactgttggaagtcagtggcaccagagggctgtctgtcggcgacctctactcc
ggcctgcagagctcggggtggctccgccacgtccaggccgtcctgggcgccgcagtcgtc
ttagccaaggcagtaacgaccgagagtgccagtgtgttggtccattgctctgacggctgg
gacaggacctcccaggtttgctccctgggctccctcctgctggatccctactacaggaca
gtcagaggattcatggttttaatagaaaaggattggatctcctttggacataagttttca
gagaggtgcggccatctggatggggaccccaaagaagtctccccggtgttcactcagttc
ttggaatgcgtgtggcatctgaccgaacagtttccacaagccttcgaattcaatgaagcg
tttcttcttcagatccacgaacatattcattcatgccaatttggaaactttattggaaat
tgtcagaaggaaagagaagaactcaagctgaaggagaagacgtactcgctgtggccgttt
ctgttggaagatcgagtgaagtacttaaatcctctctaccagccccaggctcaggaattt
gcagttttggaaccaaatacagtatctttcaatttcaagttttggagaaacatgtaccac
cagtttgatcgaactttgcatcctaggcagtctgtgtttaatataattgcgaatatgaac
gagcaaaataaacagttggagaacgacattaaggacttggaatctcaaattaagcaatgt
aaaaataagcaagcagatggagttctcaccaaggaattgttaaattcagttcgtcctgaa
tcacctacgctcaaaacttccttgtgttttaaggagcagacgctgctccccggaaatgat
gctcttcgaactatagacagcagcaacccggcggataatcggtacagcgaatacgccgag
gagttttccaagccggaccccgccgtggtcagcctggagtacggcgtggcgaggatgacc
tgttag

DBGET integrated database retrieval system