KEGG   Camelus dromedarius (Arabian camel): 105097188
Entry
105097188         CDS       T04642                                 

Gene name
ASIC1
Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105097188 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cdk04040]
    105097188 (ASIC1)
Ion channels [BR:cdk04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   105097188 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 105097188
NCBI-ProteinID: XP_031318453
Position
12
AA seq 526 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLEXFDYAYEVIKHKLCRRGKCQKEAKRTSTDK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcgctctgggccctgtgcttcctgggctcactggctgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggta
gctgcctcccagctcaccttccctgctgtcacgctgtgcaatctcaacgagttccgcttt
agccaagtctccaagaacgacctgtaccacgctggggagctgcttgccttgctcaacaac
aggtatgagataccggacacacagatggcagatgaaaagcagctggagatactgcaggac
aaggccaacttccgcagcttcaagcccaagcccttcaatatgcgcgagttctacgaccgt
gcagggcacgatattcgagacatgctgctctcctgccacttcaggggggaggtctgcagc
gcagaggacttcaaggtggtcttcacacggtatggaaaatgctacacgttcaactctggc
cgagatgggcgtccacggctgaagacgatgaagggtgggacaggcaatgggctggaaatc
atgctggacatccagcaggatgaatacctgcccgtatggggggagaccgatgagacgtca
tttgaagcaggcatcaaagtgcagatccacagtcaggatgaacctcccttcattgaccag
ctgggctttggcgtagccccagggttccagacctttgtggcctgccaagagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggacttggatttcttc
gactcctacagcattaccgcctgccgcattgactgtgagacacgttacctggtggagaac
tgtaactgtcgcatggtgcacatgccaggggatgccccatactgcactccagagcagtac
aaggagtgtgcagatcctgctctagacttcctggtggagaaggaccaggagtactgtgtg
tgtgaaatgccctgcaacttgacccgttatggcaaggagctgtccatggtcaagatcccc
agcaaagcgtcagccaagtacctggccaagaagttcaacaaatctgagcagtacataggg
gagaacatcctggtactggacattttctttgaagtcctcaactatgagaccattgagcag
aagaaagcctatgagattgcagggctcctgggtgacattgggggccagatggggctgttc
atcggggccagcatcctcacggtgctggagnnctttgactatgcttacgaggtcattaaa
cacaagctgtgcagacgagggaagtgccagaaggaggccaaaaggaccagcacggacaag
ggcgtggccctcagcctggatgacgtcaaaagacacaacccgtgtgagagcctccggggc
catcctgccgggatgacgtatgctgccaacatcctacctcaccatccggcccgaggcact
tttgaggactttacctgctga

DBGET integrated database retrieval system