KEGG   Camelus dromedarius (Arabian camel): 105097237Help
Entry
105097237         CDS       T04642                                 

Gene name
PAPOLG
Definition
(RefSeq) poly(A) polymerase gamma isoform X3
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    105097237 (PAPOLG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105097237 (PAPOLG)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     105097237 (PAPOLG)
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     105097237 (PAPOLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2 Nrap_D2 DUF4269
Motif
Other DBs
NCBI-GeneID: 105097237
NCBI-ProteinID: XP_010988060
Position
15
AA seq 748 aa AA seqDB search
MKEMSANTMLDSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHR
LVVLGKLNNLVKEWISEVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAP
RHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDN
LDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNML
GFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWD
PRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKL
LEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSF
PGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGM
KIEATHVKKKQLHHYLPAEILQKKKKQSLSDVSRSSSGPQSKRSSLDGSCLDSSRDTDNG
TPFNSPVSASKPAKPDVTPSGETERNNADPAGIIVEKPLSVPPAQGLSIPVIGAKVDSAV
RAVSPPAVCTIPTVVGRNVIPRITTPHNSTQGQPHLNGMSNITKNVTPKRSHSPSIDGSS
KRLKDIEKFIRLESTFKESRAAEDRKRKSVDAIGGECMPIPTIDTSRKKRLPSKELPDSS
SPVPANNIRVIKNSIRLTLNRSLSVGES
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatgtctgcaaacaccatgctggacagccagcgtcaacaaaagcattatgga
atcacttctccaattagcttggcatgtcctaaagaaatagatcatatatacacacagaaa
ttaattgatgccatgaaaccatttggagtatttgaagatgaggaagaattgaaccatagg
ctggttgttcttggtaaactgaacaatttagtaaaagaatggatttctgaggtcagtgag
agtaagaatctcccaccttctgttgtggctactgttggtggaaaaattttcacttttggc
tcctacagacttggagtacacaccaaaggagctgacattgatgcactttgtgtagctcca
agacatgtggagagatctgatttttttcagtctttttttgaaaaattgaaacatcaagat
ggcattagaaacttaagagctgtagaagatgcctttgtgcctgttataaaatttgaattt
gatggaattgaaattgatctagtctttgcaagactggcaatacaaaccatatcagataat
ttagatctaagagacgactctcgactgagaagccttgatataaggtgtattcgcagccta
aatggttgtagagttactgatgaaattttgcatttagtgccaaataaagaaactttcaga
ctcaccctaagagcagtcaaactgtgggcaaaacgacgtggtatttattccaacatgctg
ggattccttggtggtgtctcctgggcaatgctagttgcaagaacttgccaattatatcca
aatgcagcagcttctactttagttcataagttctttttagttttttccaagtgggaatgg
ccaaatcctgtgctgctgaagcaaccggaagaaagtaatttgaatttgccagtttgggat
cctcgggtaaatccatcagataggtatcatctcatgcccataatcacccctgcctaccca
caacagaattctacgtataatgtgtccacatcaactcgaacagtaatggtagaagaattt
aaacaaggtcttgcagtcacagatgaaattcttcaagggaaatcagactggtccaaacta
cttgagccaccaaatttttttcaaaagtatagacattatatagtattgactgccagtgca
tcaacagaagaaaatcatctagagtgggttggattagtagaatctaaaatacgtgtactt
gttggaaacttggaacggaatgaatttattactcttgcccatgtaaatccccagtcattc
ccaggaaataaggaacatcataaagacaacaattatgtatcaatgtggttccttggaata
attttccggagagtagaaaatgcagaaagtgttaatatagacctgacatatgatatacag
tcatttactgatacagtgtacagacaggcaaacaatataaacatgctaaaggagggaatg
aaaattgaagcaactcatgttaaaaaaaaacaacttcatcactaccttcccgcagagatt
cttcaaaagaaaaaaaagcaaagtctttctgatgtcagtcgaagttcaagtggccctcag
tccaaaagatcatctctggatggcagttgtttggacagctccagagacactgataatgga
acaccttttaattccccagtgtctgcaagcaaacctgccaagcctgatgttactccttca
ggagagacagaaaggaataatgctgatcctgctggtataattgtggaaaagccactgagt
gtcccgccagcacaagggctatctattccggtcattggtgcaaaagttgactctgcagta
agagctgtatcacccccagctgtatgtaccattcctactgtagtaggacgaaatgtcatt
cctagaatcacaacaccccacaactctacccaggggcaaccacatctaaacggaatgtca
aatataactaagaatgttacacctaagagatcccattccccatccatcgatgggtcttct
aagaggttgaaagacatagagaagtttattcgacttgaatcaacatttaaggaatcacgt
gctgctgaagacagaaaaagaaaatcagtggatgcaattggaggagaatgtatgcctatt
ccaactattgacacatcacgcaaaaagagactgcccagtaaagaactcccagattcatca
tctccagttccagcaaataacatccgtgtcatcaaaaattccattcgactgaccctaaat
cgatctttaagtgtgggggaaagttga

DBGET integrated database retrieval system