KEGG   Camelus dromedarius (Arabian camel): 105097615Help
Entry
105097615         CDS       T04642                                 

Gene name
METTL3
Definition
(RefSeq) methyltransferase like 3
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105097615 (METTL3)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     105097615 (METTL3)
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     105097615 (METTL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF445 DUF5521
Motif
Other DBs
NCBI-GeneID: 105097615
NCBI-ProteinID: XP_010988474
Position
Un
AA seq 580 aa AA seqDB search
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPAAPTSGG
PKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSIRLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTITGQKRRA
EQDSTTVAAFASSLASGLASSASEVAKEPTKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacacgtggagctcgatccaggcccacaaaaagcagctggactcgctgcgggag
aggctgcagcggaggcggaagcaggactcggggcacttggatcttcggaatccagaggca
gcactgtcaccaaccttccgtagtgacagcccagtgcctgctgcacccacttctgggggc
cccaagcccagcacagcttcagcagttcctgaactggctacagaccccgaattagagaag
aagttgctacaccacctctctgatctggcactaacattgcccactgatgctgtgtccatc
cgtcttgccatctccacgccagatgcccctgccactcaggatggggtggaaagcctccta
cagaagtttgcagctcaggagttgattgaggtaaagcgaggtctcctgcaagatgatgca
catcccactctggtgacctacgctgatcattccaagctctctgctatgatgggtgctgtg
gcagaaaagaagggcccgggggaggtagcagggactatcacagggcagaagcggcgtgca
gaacaggactcgaccacagtagctgcctttgctagctctttggcctctggtctggcctct
tcagcatcagaagtcgccaaggagccaaccaagaaatcaaggaaacatgctgcctcagat
gttgatctggagatagagagccttctgaaccaacagtctactaaggaacaacagagcaag
aaggttagtcaggaaatcctagagctattaaatactacaacagccaaggagcaatccatt
gttgaaaagttccgctcacgaggtcgggcccaagtgcaagagttctgtgactatggaacc
aaggaggagtgcatgaaagccagtgatgctgaccggccctgtcgcaaactgcatttcaga
cgaatcatcaataaacacactgatgagtcattaggtgactgctctttccttaacacatgt
ttccatatggatacctgcaaatatgttcactatgaaattgatgcttgcatggattctgag
gctcctggaagcaaagaccacacaccaagccaggagcttgcccttacacagagcgttgga
ggtgactccagtgcagatcgactcttcccacctcagtggatctgttgtgatatccgctac
ctggacgtcagtatcttgggcaagtttgcagttgtgatggctgacccaccctgggatatt
cacatggagctgccctatgggaccctgacagatgatgagatgcgcaggctcaacatacca
gtactgcaggatgatggctttctcttcctctgggtcacaggcagggccatggagttgggg
agagaatgtctgaacctctggggttatgaacgggtagatgaaattatctgggtgaagaca
aaccaactgcagcgcatcattcggacaggccgcacaggccactggttgaaccatgggaag
gaacactgcttggttggtgtcaaaggaaatccccaaggcttcaaccagggtctggattgt
gatgtgatcgtagctgaggttcgttccactagtcataaaccagatgaaatctatggcatg
attgagagactgtcccctggcactcgcaagattgagttatttggacgaccacacaatgtg
caacctaactggatcacccttggaaaccaactggatgggatccacctactagacccagac
gtggttgctcggttcaagcaaaggtatccagatggtatcatctctaaacctaagaaccta
tag

DBGET integrated database retrieval system