KEGG   Camelus dromedarius (Arabian camel): 105098680Help
Entry
105098680         CDS       T04642                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05410  Hypertrophic cardiomyopathy (HCM)
cdk05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    105098680
   05414 Dilated cardiomyopathy (DCM)
    105098680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105098680
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105098680
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cdk04812]
    105098680
   04147 Exosome [BR:cdk04147]
    105098680
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105098680
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105098680
Membrane trafficking [BR:cdk04131]
 Others
  Actin-binding proteins
   Others
    105098680
Cytoskeleton proteins [BR:cdk04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105098680
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105098680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Titin_Z Pkinase fn3_4 C1-set Pkinase_Tyr PPAK Adeno_E3_CR1 Izumo-Ig THB
Motif
Other DBs
NCBI-GeneID: 105098680
NCBI-ProteinID: XP_031307593
Position
5
AA seq 31837 aa AA seqDB search
FFDFSFVCLLNTIDYTIIILFPHAEFSSSLLSAEQERLQTDSSGIHLSSRNETLELLSEP
PVHSTKLDSKKEGSVPVFIKEVSNAEINIGDVVKLSVTVTGFPKPQIQWFFNGVMLTPSA
DYRFVFDGNDHSLIILFTKFEDEGEYTCIASNEYGQAICSAYLKINSKAEGLRETEPEEK
SPEKLEGPCPPYFLKELKPIRCAQGLPAIFEYMVLGEPTPTVLWFKENKQLCTNVYYTII
HNPDGSGTFIVNDPQREDSGLYVCKAENVWGESTCAAELLVLPEDTHMIDAPCKATSMPE
APEDFPQTSLKVPTLDSEQEIAAFVKDTVLKAALMAEEKQQLSYEHIVKTSELSSQVTLV
AEQRQSTVMLEQKMPTPESTREHLSISGTIHVQPRKEPPPNLQLQIVQSQKTLPKEDILI
HQEPESQVVLSGTEKIFPSAMSIEEISPLTAEPLKTLLAEPKGSYPQLSIEETPAHSYPT
SVTEEVLLPKEKTVSTVEKEQRVTLQKPEAQSALILERSLAEGHVERIQGPDVLISQVPS
EHTGTEDEILMESADQLDSAGQDFAARVEEGKSLRFPLACEEKQVLLKEEHSDHWAMPPN
QTTEYTKEPMAIHGVQEVQGSDILSKESLLSGIPEEQRLHLKTQIRRALQAAVASEQLSL
FSEGLRNIEKVEVKAINFTQEPNCIMCTYLITSVKSLTEELTIILEGIDPQMANLKTELK
DALCSLICEEMNILTAEEPRVQKGDQTGLLEEMGTFSEPQKVDTITEPEVESKYLVSTEE
VSYFHVESQVKAVTTATTSTAISGEKQGGIPKPSEEKEKSSEGDTEEEVGPVEIQEAEGG
FLREDGPVVRTPLVDTMAEEGNTVSLTSSITDAREVNWYFESKLVPSDEKFKCLQDQNTY
TLVIDQVNTEEHQGEYTCEALNDHGRAATSAKLTVVKRAAPVIRRRIEPLDVALGHLAKF
TCEIHGAPNVRFQWFKAGREIYESDKCSIRSANYVSTLEILRTQAVDCGEYTCQASNEYG
SASCTATLTVTEAYPPTFFSRPKSVTTFVGKAAKFLCTVTGTPVIETIWQKDGVALSPSP
HCKISDVDNKHILELSNLTIQDRGVYSCKASNKFGADICQAELTIIDKPHFIKELDSVQS
AINKKIHLEGQVDEDRKVTVTWSKNGQKLPPGKDYKIYFEDKIASLEIPLAKLKDSGTYV
CTVSNEAGSSSSSATVTIREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNN
KELTESNTIRMSFVNSEAVLDITDVKVEDSGTYSCEAVNDVGSDSCSAEIVIKEPPSFIK
TLEPADIVRGTNALLQCEISGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVSLEIFSFNS
ADVGEYECVVANEVGKCGCIATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISV
TWMKGQEIIKEDGKIKMSFSSGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE
PAKIIERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLVASKKYRLSFKNNVAQLK
FYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSIVSGACRLDCK
IAGSLPMRVSWFKDGKEVAASDRYRIAFVEGTASLEISRVDVNDAGNFTCRATNSVGSKD
CSGALIVQEPPSFVTKPASKDVLPGSVVSLKSTFQGSAPLTVKWFKGDKELVSGGSCYIT
REAFESSLELYVVKTSDSGTYTCKVSNVAGTMECSANLFVKEPATFIEKLEPSQLLKKGD
ATQLACKVTGTPPIKITWFVNDREIKESSKHKMSFVESTAVLTLTDIAVEDSGEYMCEAQ
NEAGSDHCGSILIVKESPYFTKEFKPLEVLKEYDVMLLAEVAGTPPYEITWFKDNTTLRS
GRKYKTFIQDQLVSLQILKFVAADVGEYQCRVTNEVGSATCSARVTLREPPAFVKKIEST
SSLRGGTAAFQATLKGSLPIMVTWLKDNDEITEDENIRMTFENNVASLYLSGIEVKHDGK
YVCQAKNDAGIQRCSALLSVKEPATIIEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKD
GQELTLGQKYKISVTETVSILKIISTEKRDSGEYTFEVQNDVGRSSCKASINVLDLIIPP
SFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEITASEKYKFSFHDNTAFLEIS
QLEGADSGTYTCSATNKAGHNQCSGRLTVKEPPYFMEKPQSQDVNPNTRVQLKALVGGTA
PMTIKWFKDNKELHSGAARSVWKDDTSTVLELFSAKAADSGTYICQLSNDVGTAASKATL
FVKEPPQFIKKPSPVVVLRNGQSTTFECQITGTPEIRVSWYLDGNEITAIKKHGISFIDG
LATFQISDARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELRPAEVVRDSDVELE
CEVMGTAPFEVTWLKNNREIRSSKKYTLTDRVSVFNLSINKCDPSDTGEYQCIVSNEGGS
CSCSARVSLKEPPSFVRKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVH
VSFVNNVATLQVRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQILEKAKSVDVTEK
DPVTLECVVAGTPELRVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGEYTFKV
ENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGK
EITTSAKYRLVCHENTVLLDVNNLELEDTANYTCRVTNVAGDDACSGILTVKEPPSFLVK
PERQQAVPDSTVEFKAVLKGTPPFKIKWFKDDVELASGPKCFIGLEGSTSFLNLYSVDAS
KTGQYTCQVTNDVGSDSCTTMLLVTEPPKFVKKLEAFKIVKAGDSARLECKITGSPEIRV
VWYRNEHELPPSDKYRMAFIDSVAVLQMNYLGTEDSADFICEAQNPAGSTSCSTKVIVKE
PPVFSSFPPVVETLKNTEVTLECELAGTPPFEVVWYKDKRQLRSSKKYKIASKNFHASIH
ILSVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQATIEG
APPISVQWLKDKEEVVRESENTRITFVENVATLQFTKAEPADAGKYICQIKNDGGVRENM
ATLTVLEPAVIVEKAGPMTVTVGDTCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFY
NKISSLKILSIEKQDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRRLKDTVGVLGA
SCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDWSDMGNYTCVAA
NVAGSDECRAVLAVQEPPSFVKEPEPLEVLPGKDVTFTSVIRGTPPFKVGWFRGARELVK
GDRCNIYFEDTVAELELFNVDIGQSGEYTCVVSNNAGQTSCTTHLFVKEPAAFVKKLSDH
SVEPGRSIILESTYTGTLPISVTWKKDGFNIRPSERCSIVTTEKTCILEILNSTKRDAGQ
YTCEIENEAGSDVCKALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWYKG
DTKLRPTPEYRTYFTNNVATLVFNKVAISDSGEYTCKAENSIGTAFSKTVFRIQERQLPP
SFARQLKDVEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKIL
QTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVT
GAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCS
AQLSVKEPPKFVKKLEASKIAKQGESIQLECRISGSPEIKVAWFRNDSELHESWKYNMSF
VNSMALLTISEASTEDSGDYICEAHNGVGDTSCSTALTVKAPPVFIQKPSPVGALKGSDV
VLQCEISGTPPFEVVWIKDRKQIRSSKKFKVTSKNFDTSLHILNLEASDVGEYHCKAANE
VGSDTCVCTVKFKEPPRFVKKLSDTSTLIGDAVELRAVVEGFQPISVVWLKDKGEVIRES
ENTRISFVDNVATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMT
VTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFVNKVASLKIPCAEMSDKGLY
SFEVKNSVGKSNCTVSVHVSDRVVPPSFIRKLKDISAIVGASAVLECRVSGSAPISVGWF
QDGNEIISGPKCQSSFSENVCALNLSFLESSDTGIYTCVAANVAGSDECSAVLTVQEPPS
FEQTPDSVEVLPGTSLTFTSVIRGTPPFKVKWFKGSRELVSGESCSISLEDFVTELDLFE
VEPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPP
ISVSWMKNEFPLTQSQNCSITMTERSTILEILDSTIEDYAQYSCLIENEAGQDICDALVS
VLEPPYFIEPLEHVEATIGEPVTLRCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVA
SLVINKVDHSDVGEYTCKAENSVGAVASSSVLVIKERKLPPSFARKLKDVQETLGFPVAF
ECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDHSHVGQYNCSASNPFG
TASSSARLLLSEHEVPPFFDLKPVSVDLALGESGSFKCHITGTAPIKITWAKDNREIRPG
GNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAHLGVQEPPRFIKKLEPSR
IVKQDEYTRYECKIGGSPEIKVLWYKDETELQESSKFRMSFVDSVAVLEMHDVRVEDSGD
YTCEARNAAGSASSSTSLKVKEPPTFRKKPHPVETLKGADVHLECELQGTPPFQVSWHKD
KRELRSGKKYKIMSENFLTSVHILNVDTADVGEYQCRATNDVGSDTCVGSIALKAPPRFV
KKPSDVSTIVGEEVQLQATIEGAEPISVMWFKDKGEVVRESDDIWISYSENIATLHFSTT
EIANAGKYTCQIRNDAGMQECSTTLSILEPAAIVEKPESIKVTTGDTCTLECTVTGTPEL
TTKWFKDGKELTSDSKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASVQV
SDRTVPPSFTRKLKETHGLSGSSVIMECKVYGSPPISVSWFHEGSEISSGRKYQTTLTDN
TCALTVNMLEDSDAGDYTCIATNAAGSDECSAPLTVREPPSFVQKPELMDVLTGTNVTFT
SIVKGTPPFSVSWFKGSSEIVPGDRCNVSLEDSVAELELFDVDASHSGEYTCIVSNEAGK
ASYTTHLHVKAPAKFVKKLNDYSIEKGKPLILEGTYTGTPPISVTWKKNGINIAPSQRCN
ITTTERSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVTVG
DSASLQCQLAGSPEIAVSWFKGDTKLRPTATYKMHFRNNVATLVFNQVDTNDSGEYICRA
ENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVHETVGLPVVFECAISGSEPISVSWFKDGR
PLKDGPNVQTSFLDNVATLNIFQTDRSFAGQYSCTATNPIGSASSSARLVLTEGKNPPFF
DIPLAPVDAVVGESADFECHVTGTQPIKVAWAKDNREIRSGGNYQISYLENSAHLTILKV
DKGDSGQYTCYAVNEVGKDSCTAPLNIKERLIPPSFTKKLSETVEETEGNSFKLEGRVAG
SQPITVAWYKNNIEIHPTPNCEITFKNNALLLQVRKAGVGDAGLYTCKVSNDAGSALCTS
SIVIREPKKPPVFDQHLTPVTVTEGEFMQLSCHVRGSEPIRIQWLKAGREIKPSDRCSFS
FANGTAVLELKDVAKGDAGDYVCKASNVAGSDTSKSKVTIKDKPAAVPAAKKAAVDGKLF
FISEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRIFIHQKGDEAKLEIR
DTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPALKKGAGEEE
EIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIEKSEKE
EREFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTE
KLEPSDKFEISIDGDRHTLRVRNCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVT
LKEGQTCTMTCQFSVPNVKSEWFRNGRIFKPQGRYKTEVEHKVHKLTIADVRAEDQGQYT
CKYEDLETSAELRIEAEPIQFTRRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTE
SQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLEMKPP
DIPDSRVPIPTMPIRAVPPEEIPPTAVPPIPLLLPLPEEKKPPAKRIEVTKKAVKKDAKR
VAKPKEAPPEVPEVAKKPPPPTALIPAKAAEIIDVSSKAEEVKITTITRKKEVQKEKEAV
YEKKQAVYEEKRLFIESVEEPYDELEMEPYTEPFEEPYYEEPDEDYEETKVEAEREVHEE
WEEDFEEGQEYYERAEGYDEEEEEWEETYQEGEVIQVQKEVYEGVYSLESQERKIPAKVP
EKKAAPPPKVVKKPIVEKIEKTSRRMEEEKVQVTKVPEVSKKIVPQKPSRTPVQEEVIEV
KVPAVHTKKMVISEEKMFLASHTEEEVSVTVPEVQKKIITEEKVHVAVSKKTEPPPKVPE
PPKKPVPEEVVPVPVPKKVEPPPAKVPEVPKKPVPEEKKPVPVPKKEPPAPPKVPEVTKK
PVPEEKVPVPVPKKKEAPPAKVPEVQKRVVTEEKVTVITEREESPPPAVPEIPKKKVPEE
KRPVPRKEEEVPPPKVPALPKKPVPEEKVPVPVPVAKKAPPPRAEVSKKTVVEEKRFAAE
EKLSVAVPQRVEVMRHEEEEWSYSKEEERISVSVYREEEREEEEEEVEVTEYEVMEEPEE
YVVEEEELHLVSERVEAEAVEVPEKKIVPKPKIPAKIEEPPPAKVPEVPKKIVPEKKIPA
AVPKKEKVPPAKVPEEPKKPVPEKRAPPKVAKIEEPPPTKVTERHMQITQEEKVHVAVTK
KVEPPRPRVPEEPKRAVPEEKVPKLKPKKEEEPPARVTELRKRAVKEEKVSIEVPKREPH
VAKEVTVTEEKEWSYAREEEVQREEEYEDYEEYDYKEFEEYEPTEEYEQYEEYEEREVEH
YEEYITEPEKPIPVKPVPEEPVPTKPKAPPAKVPKKAVPEEKVPVLIPKKLKPLPPKAPE
EAKKVVEEKIHISITKREKEQVTTEPAAKVPLKPKRVVTEEKVPVPKKEVAAPVKVPEVP
TREEEPEEIAFEEEVVTQVEEYFEEEEEYLHEEEEIVTEEEVVPVIPVKVPEVPKKPVPE
EKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIAKKEKAPPAKVPEVPKKPVPEEKVPVP
VPKKVEAPPAKVPEVPKKPVPEKKVPVPAPKKVEAPPAKVPEVPKKIIPEEKKPTPVPKK
VEAPPPKVPKKREPVPVPVPVALLRKEEVTFEEEIVLEEEVLPEEEEVLPEEEEVPPEEE
EILPEEEEVPPEEEEFPPEEEEVPPEEEEIPPEEEEFVPKEEVLPEIKPKVPVPARVPEV
PKKPVPEKKVPVPAPKKVEPPPPKVPEVKKKVPEKKVIVPKKEEAPPAAVPVVPKKPEPE
KKVPPPALKKAVAPPAKEPEVTKKPVPEVPTAPPKKVEAPAVKVPEVPKKVEERRIIVPK
EEEVPPVEVFEEPEEPEEPEEPEEPEELEELEEPEEPIPEEEIPEEPPSIEAIEEVAPPR
VPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVAEEKIPVPVQKKEAPPAKVPEVQKKFPEK
KVPEKKIPEKKVPEKKVPVPKKEAVPPAKGRTVLAEKISVAFHKEEVVEERTEFEVVEAQ
VEEALEEEEFREVEEYFEEEEFHEVEEFVKVEEYRAEEVHRAEEVHRVIEVLEAEEVEVY
EKPKAPPKGPEISEKIIPPKKPPTKVVPRKEPPAKVPEVPKKIVVEEKVRVPEEPKIPPA
KAREVPKKIVPEEKVREAVPKEPEVPPAKVLDEVLEVHKKSIQEEESPIVLSEDATIYIY
EVSEESTLEEKVLVTHPQKTKTKLAKVPETPKKVVPEDKIYVTMPKKRETPTTKEPDTTR
DVFPEVESTEAVPKIPEHPPTKELEVSKEGVPARQAPVTKRRKTPPPKVPESPQEVVPVK
ETLMAAPPEIETPSTKAEAVKEVAPEMNVSEDVLKAPEPPPVKVPEDVQEGVPAKRVPSK
KREPPPVKVPEAPQGIVPEKKTYVVRHKKLEVLPDEVPEAAEEVVWEEKLPPPQKPAVVS
VKVPEAPKEVAPEKKVPVAPPKKPEVPPVTVPEAPKEVVPEKKVPVAPPKKPEVPPVTVP
EAPKEVVPEKKVPVMPPKKPEVPPVTVPEAPKEVVPEKKVPVLPPKKPEVPPVTVPEAPK
EVVPEKKVPVMPPKKPEVPPAKVPEVPKVAVPEKKVPEVIPPKPESPPSAVPEVPPKEAI
PEKKVPVAPPKKPEAPPAKVPEVPKEVVPEKKVPVAVPKKPEVPPAKVPEAAQEVVPENK
VPKAPPKKPETPPVTVPEVPQEVVPEKKVPKAPPKKPEAPPVTVPEVPREVVPEKKVPKA
PPERPEAPPVTVPEVPQEVVPEKKVPKAPPKKPEAPRVTVPEVPREVVPEKKVPKAPPER
PEAPPVTVPEVPQEVFPEKKVPKAPPKKPEAPPVTVPEVPQEVVPEKKVPKAPPKKPEAP
RVTVPEVPQEVVPEKKVPKAPPKKPEAPPVTVPEVPQEVVPEKKVPKAPPERPEAPPVTV
PEVPQEVVPEKKVPKAPPERPEAPPVTVPEVPQEVVPVKKVPKAPPKKPEAPPVTVPEVP
REVVPEKKVPKAPPKKPEAPPVTVPEVPQEVVPEKKVPKAPPKKPEAPPVTVPEVPQEVV
PEKKVPKAPPKKPEAPPVTVPEVPKEVVPEKKVAVPKKPEVPPAKVPEVPKKPVLEEEPA
APVPKKAESPPPEVCEEPEEIAPEEEKPVPVVEEEEAEAPPPVPEEPKKIVPEKKVPVIK
EPEAPPPKVPAMAKKVVPVKKVPMVKKPETPEVKVSELPKRLVPVKKEPVPVTKKPAVLR
EKVPEVPKEIITEEKVSVPVPEEPEAPPVQVEESPEEIIYEERASITIGRKVTPPVEERE
IEKYVEPEEPEPEPQPEEIPVQEPEPEKVIEKPKLKPRPPAPPPAPPKEDVKEKIFQLKA
VSKKKVPEKPQVPEKVELKPLKVLGAEKKVRKLLPEPKPEPKEEVVLKSVLRRRPEEEEP
KVEPKKVEKIKKPAVPEPPPKPVEEVEAPPAAVPKKERKIPEPTKVPEIKPAIPLPAPEP
KPKPEPEVKIIKPPPMEPAPVPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTP
SPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECL
VSPSTAVTSWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTS
TAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGKIVPG
VIGLLRALTINDADDSDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKG
TAVFTCVIAKDTPNIKWFRGYDEIPLEPTDKTEILKDGNILYLKIKNATPEDVDEYAVEI
EGKRYPAKLTLGEREVQLLKPIEDVTIYEKESASFDAEISEADVPGQWKLKGELLRPSPT
CEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAFTTAILTVKEIELDFVVPLKDVTVPEKR
QARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINNSQFADEGVYTAEVEGK
KTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVAWFKNDAKLHTSRTVLI
SSEGKTHKLEMREVTLDDISQIKAQVKDLSSTANLKVLEADPYFTVKLHDKTAVEKDEII
LKCEVSKDVPVKWFKDGEEIVPSPRYSIKSDGLRRILKIKKAELKDKGEYVCDCGTDKTK
ANVTVEARLIKVEKPLYGVEVFVGETARFEVELSEPDVHSQWKLKGEPLTASPDCEIIED
GKKHILVLYNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFEC
EVSREPKTYRWLKGTQEITGDDKIELIKDGTRHALVIKSAAFEDEAKYIFEAEDKHTSGK
LIIEGIRLKFLTPLKDVTAKERESAVFTVELSHDNIHVRWFKNDQRQHTKRNISMHDEGK
IHSITFKDLSIDDTSQIKVEAMGLSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVVLQCEI
SKADAPVKWFKDGEEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLG
IEDREIKLVRPLYSVEVMETESARFETEISEEDIHANWKLKGEALLQTPECEIKEEGKMH
FLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSY
EDIPVEWYLRGKKLEPGEKVVTRSEGRVHTLTLRDVKLEDAGEVQLVAKDFKTQAKLIVK
EPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKL
IIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVKEKEMARFECEISREN
AKVQWFKDGAEIKKGKKYDIISKGAVRILVVNKCLLDDEAEYSCEVRTARTSGMLTVLEE
EAVFTKNLTNIEVSETDTIKLVCEVSKPGAEVVWYKGDEEIIETGRYELLTDGRKRILTI
QNAHLEDAGNYNCRLPSSRTDGRVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFE
VQWKRDDKTLESGDKYDIIADGKKRILVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLK
IIVPLKDTRVKEQQEVTFNCEVNTEGAKAKWFRNKEAIFDSSKYIILQKDLVYTLRIRNA
RLDDQDNYSVSLTNHRGENVKSAANLIVEEEELRIVEPLQDIETMEKKSVTFWCKVNRLN
VRLKWTKNGEEVAFDNRVLYRIDKYKHSLIIKDCGFPDEGEYIVTAGQDKSVADLLIIEA
PTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSVHRLII
KDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVE
VQWLKNNMIIVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPK
IKTADQDLVVDVGQPLTMVVPYEAYPKAEAEWFKENEPLSSKTVDTTAEQTSFRISEAKK
GDKGRYKIVLQNKHGKAEAFINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKI
IGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSP
VEARSKYDVPGPPLNVAITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKASIRWETAM
TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSTATPFVKVADPIERPSPPVNLNSS
DQTQSSVQLTWEPPLKDGGGPILGYIIERCEEGKDNWIRCNKKLVPELTYKVTGLQKGNK
YLYRVSAENEAGVSDPSEILGPLTADDASVEPTMDLSAFKDGLEVIVPNPIKILVPSTGY
PRPTATWSFGDKVLEAGDRVKMKTLSAYAELVISPSERPDKGIYTLKLENPVKAISGEID
VNVIARPSAPKELKFGEITKDSVHLTWEPPDDDGGSPLTGYLIEKREVSRKTWTKVMDFV
TELEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVPDPPENVKWRDRTA
NSIFLTWDPPKYDGGSRIKGYLVEKCPRGSDRWVACGEPVAETKMEVTGLEEGKWYAYRV
KALNRLGASKPSKPTDEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPK
VTWTKADMLLKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVL
DKPGPPAAFDITEVTNESCLLTWNPPRDDGGSKVTNYVVERRATDSEVWHKLSSTVKDTK
FKATKLTPNKEYIFRVAAENMYGVGEPVQATPITAKFQFDPPGPPTRLEPSDITKDAVTL
TWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPIKDTTFRVKGLTNKKKYRFRVLAEN
LAGPGKPSRSTEPVLIKDPIDPPWPPGKPTVKDIGRTSLMLNWTKPEHDGGAKIESYVIE
MLKTGTEDWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKL
YPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTK
CTVTPLTEGSLYVFRVAAENAIGQSDYCEVEDSVLAKDTFTTPGPPYALAVVDVTKRHVD
LKWEPPKNDGGKPIQRYVIEKKEKLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAE
NEAGVGHPSEPTEILTIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV
EMCPVGTEKWMRVNSRPIKDLKYKVEEGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAK
DPDCKPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKDVKASDRLTMKNDHIS
AHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWE
PPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGG
GEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAK
GEERWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPIDAP
KVIMRTSLEVRRGDEIALDATISGSPYPTITWLKDEKVIIPEEIKKRAAPLVRRRRGEVQ
EEEPFFLPLTERLSIDNSKKGESQLRVRDSLRPDHGLFMIKVENDHGIAKAPCTVSVLDI
PGPPINFIFEDVRKNSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIIVTATLRHCK
YPVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLTAKDPFEPPDAPDKPIVEDVTSNSMLV
TWNEPKDNGSPILGYWLEKREVNSTHWSRVNRNLLNALKTKVEGLLEGLTYVFRVCAENA
AGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTAIELAWEPPAFNGGGEIIGYFVDKQ
LVGTNEWSRCTEKMIKAREYTVKEVREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEP
PTVELDVSVKAGIQIMAGKTLRIPAVVTGRPVPTRVWTKEEGDLDKDRVVIENVGTKSEL
IIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPE
DDGGSDITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYMFRVIAKNKFGCGPPV
EIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDF
ERVNKRLCPTTSFLVEDLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRL
SVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEKVIEKPSDALKITKEEVSRSEAKTE
LSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAP
LDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGT
SDECKSDKVVIQDPYRPPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEG
GAYWSRVSRAPITKMGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGPPSEPSDPAVAGDP
IYPPGPPSRPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGSTDWKSVNEPDKLL
TTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDVQEVPEVFIDIGAQDCLI
CQAGTQIRIPAVIKGRPTPKSSWEFDGKAKKAVKDGVHDIPEDAQLETAENSSVIIIPEC
KRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCKLTWKMPDDDGGD
RIKGYVIEKRTIDGKAWTKVNPSCGSTSFVVPDLISGQEYFFRVRAENRFGIGPPVETIQ
RTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKE
AWKQCNKRDVEELEFTAEDLIEGGEYEFRVKAVNAAGVSKPSDTVGPVIVKDQTCPPSIE
LKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPMKPDKKEPVVYDTHVNKLVVDDTCTL
VIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWLPP
KDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGE
PLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSK
RWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPTTARDPIAP
PGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKAKDKEVRGTKLV
VTGLKEGAFYKFRVRAVNIAGIGEPGEVTDAIEMKDRIVLPDIQLDASVRDRIVVHAGGV
IRIIAYVSGKPPPTITWNMNERALPQEATIESTAISSSMVIKNCQRSHQGVYSLLAKNAA
GERKKTIIVDVLDVPGPVGIPFLPHNLTNDSCKLTWFSPEDDGGSPITNYVIEKRESDRR
AWTPVTCTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETTDALVIRDPITVPERPE
DLEVKEVTKDSVTLTWNPPKYDGGSEIINYILESRLIGTEKFHKVTNDNLLGRKYTVKGL
KEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTIRVGEAFALTGR
YSGKPKPKVTWFKDDADVLEDDRTHIKTTPMTLALEKLKAKRSDSGKYCVVVENSTGSRK
GFCQVNVVDRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKETGKDVWMP
VTSASAKTTCKVPKLLEGKDYIFRIYAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVT
EVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWARVTKEPIHPHTKFRVPDLLEGCH
YEFRVSAENEIGIGDPSPPSKPVIAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGG
SKILGYIVEYQKVGDEEWKRANHTPESCPETKYKVTGLRDGQSYKFRVIAVNEAGESDPA
HVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKGDREAPT
KARIDTTPVGSKLEIRNALHEDGGMYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEI
RKDSCYLTWKEPLDDGGSVITNYVVERKDVASAQWSPLSTTSKKKSHMAKHLNEGNQYLF
RVAAENQYGRGPFVETLKPIKALDPLHPPGPPKNLHHVDVDKTEVSLVWNKPDRDGGSPI
TGYLVEYQEEGTEDWIKFKTVTNLECVVTGLQQGKTYRFRVRAENIVGLGLPDTTIPIEC
QEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPIPTAKWTTDGNEIKTDEHYTVET
DNFSSVLTIKNCLRKDTGEYQITVSNAAGTKTVAVHLTVLDVPGPPTGPINILEVTPEHM
TISWQPPKDDGGSPVINYIVEKKDTKKDTWGVVSSGSSKTKLKVPHLQKGCEYVFRVKAE
NKIGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYME
RREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSGPSPSSDPIKACRPI
KPPGPPINPKLKDKTRETADLVWTKPLSDGGSPILGYVVECQKAGTTQWSRINKDELIRQ
CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVR
VGQTIRILARVKGRPEPDITWSKEGKALVREKRVDLIHDLPRVELHIKEAVRADHGKYII
SAKNSSGHAQGHAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYR
KPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRP
GEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKDTHYM
VDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRL
EAGVRGKPFPEVLWTKDRDATDLTRSPRVKIETGADSSKFSLTKAKRSDGGKYVITATNT
AGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCSLHWDPPEDDGGCEIQNYIVEKCESKRM
VWSTFSSTILTPGATVTRLIEGNEYIFRVRAENKIGTGPPTETKPVIAKTKYDRPGRPDP
PEVTKVSKEEMTVVWTPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRLKVQNLL
PGHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNLKVVDTTKSSITLGWGKPV
YDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQN
QVGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWR
KVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGP
VSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWATVTPEVKKTSFHVTN
LVPGNEYFFRVTAVNEYGPGVPADVPKPVLASDPLSEPDPPRKLEVTEMTKNSAALAWLP
PLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVVARNAVGL
SLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPYPICKWKKGEDEVVT
SSHLAVHKADNSSVLIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMDAPGPPQPPFDI
SDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQE
YVFRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKNARVTKVNKDCIFVAWDRPDSDGGS
PITGYLIERKEKNSLLWVKANDTPVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT
EYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNT
SPHQIPQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIVAESVPPRIDLSVAM
KSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTPLKPSEGIKMAMKRNLCTLELFSVNRK
DSGDYTITAENASGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEIT
NYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPIITEPAIA
KNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKP
VIERTIKATGLQEGTEYEFRVIAINKAGPGKPSDASKAAYAQDPLYPPGPPAFPKVYDTT
RSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKLQKTRFEVTGLMENTEYQ
FRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRP
PPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVV
KVLDTPGPPVNVTVKEISKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECS
KTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKVTSLTKSSCS
IAWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLSLQYSTKDLTEGKEYAFRVSAENEN
GEGTPSEISVVAKDDVVAPDLDLKDLPDLCYVAKENSNFRLKIPIKGKPAPSVSWKKGED
PLATDTRVSVESSAVNTTLVVYDCRKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTG
PIKFEEVTAEAVTLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVMRLH
EGMEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRK
TGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKP
SLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKTWM
KANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLD
PTIKDGLTVKAGDTIVLSAISILGKPLPKSTWSKAGKDIRPSDIVQISSTPTSSMLAIKY
ATRKDAGEYTITATNPFGTKGEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGG
SPIKSYVLEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYLFRVSAVNQYGKGEPVESE
PVKMVDRFGPPGPPGKPDVSNVTKNTATINWKRPVDDGGSEITGYHVERREKKGLRWMRA
TKTPVSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSEASNPVLMKDVAYPPGPPSNARV
TDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITEFVVPDLQTK
EKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIK
GRPAPEVTWTKDDINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVN
VRVLDTPGPVLNLRPTDITKESVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKC
HKCTYKVTGLSEGCEYFFRVMAENEYGIGEPAETTEPVKASEAPSPPDSLNIMDITKSTV
SLAWPKPKHDGGSRITGYVIEAQRKGSDQWTHITTVKGLECVVKNLTEGEEYTFQVMAVN
SAGRSAPRESRPVIVKEQTMLPALDLRGIYQKLVIAKAGDNIKVEIPVLGQPKPTVTWKK
GDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGP
PTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWAELATTVIRTTYKAT
RLTTGMEYQFRVKAQNRYGVGPGITSASVVANYPFKVPGPPGTPQVTAVSKEAITISWHE
PLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGK
SKPSKPSEPALALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNG
RWLKANFSNILENEFTVSGLTEDARYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRI
MVDVKFKDTITVKAGEAFKLEADVSGRPPPTMEWTKDGKELENTAKLEIKTADFSTNLVN
KDSLRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLD
DGGAKIDHYVVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL
ESEPVLAVDPYGPPDPPKNPEVTAITKESMVVCWGHPDSDGGSEIINYIVERRDKAGQRW
VKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGVSAPSATSPFYKACDAVFKPGPPGN
PRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWKIVTPPAGLKATSYTITNL
VENQEYKIRIYAMNSEGIGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLF
VPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKS
AFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTV
ATNCHKTSWKIDQLQEGCSYYFRVLAENEYGIGLPAETAESVKVSERPLPPGKITLVDVT
RNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWVTCATVKVTEATITGLIQGEEYSFRV
SAQNEKGISDPRQLSVTVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTW
HKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYVVKLTNSAGEATETLNVIVLDKP
GPPTGPVKIDEVTADSITLSWDPPKYDGGSSINNYIVEKRDTSSTTWQIVSATVARTTIK
ACRLKTGCEYQFRIAAENRYGKSTYLNSESVVAQYPFKVPGPPGTPFVTLSSKDSMEVQW
NEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLDEGIEYEFRVSAENIV
GIGKPSKVSECYAARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELP
EGRWMKASFTNVIDTQFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDETEPP
RIRMDPKYKDTVVVHAGELFKIDADIYGKPIPTTEWIKGDQELSNTARLEIKSTDFATSL
SVKDAVRVDSGNYILKAKNVAGEKSVTVSVKVLDRPGPPEGPIVISGVTAEKCTLAWKPP
LQDGGSDIINYIVERRETSRLVWTVVDANVQTLSSKVTKLLEGNEYVFRVMAVNKHGVGE
PLESEPVIAKNPFVVPDAPKAPEITAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGI
RWTRCHRRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAHQKACDPIYKPGPP
NNPRVTDITRSSVFLSWGKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGISKTNIEVE
KLLEKHEYNFRICAVNKAGVGEHADVPGPVTVEEKLEAPDIDLDLELRKIINIRAGGSLR
LFVPIKGRPTPEVKWGKMDGEIRDAAIIDITSSFTSLVLDNVNRYDTGKYTLTLENSSGT
KSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYA
AVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAHTDEPVKVAEVPQPPGKITVDD
VTRNSVSLSWTKPEHDGGSKILQYIVEMQAKRSEKWSECARVKSLEAVITNLTQGEEYLF
RVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFNSYSIQVGQDLKIEVPISGRPKPTI
TWTKDGLPLKQTTRINVTDSLDLTVLSIKETHKDDGGHYGITVANVVGQKTASIEIITLD
KPDPPKGPVKFDEVSAESITLSWEPPLYTGGCQITNYIVQKRDTTTTVWEVVSATVARTT
LKVTKLKTGTEYQFRIFAENRYGQSFALESEPIVAQYPYKEPGPPGTPFVTAISKDSMVV
QWHEPVNNGGSPVIGYHLEKKERNSILWTKVNKTIIHDTQFKAANLEEGIEYEFRVYAEN
IVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEITLQWTKPAYDGGSVITGYIVEKRD
LPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVLAKNAAGTISKPSDSTGPITARDEVE
LPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKA
LLIIKDAIRIDSGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLTWS
PPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKITKLLEGNEYIFRIMAVNKYGV
GEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRS
GIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPG
PPINAHVVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRASRFE
ISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGS
VRIHIPFKGRPTPEITWSREEGEFTDKVQTEKGANYTQLSIDNCDRNDAGKYILKLENSS
GSKSAFVTVKVLDTPGPPQNLAVKDVKKDSVLLVWEPPIIDGGAKVKNYVIDKRESTRKA
YANVSNKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTL
TDVSQTSASLMWEKPEHDGGSRILGYVVEMQPRGTEKWSVVAESKVCNAVVTGLSSGQEY
QFRVKAYNEKGQSDPRVLGVPVIAKDLTIPPTFKLPFNTYTVQAREDLKIEIPVIGRPRP
SISWVKDGEPLKQTTRVNVEETATSTILHIKESNKDDFGKYTVTATNSAGTATENLSIIV
LEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVAR
TTIKITKLKTGSEYQFRIFAENRYGKSAPLDSKPVTVQYPFKEPGPPGTPFVTSVSKDQM
LVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTAIDEGLEYEFKVSA
ENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEK
KDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDE
IDAPNASLDPKYKDLIVVRAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI
QKTTLVVKDCIRSDGGQYILKLSNVGGIKSIPITVKVLDRPGPPEGPLKVSGVTAEKCYL
AWNPPLEDGGASISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNK
YGIGEPLESEPVIARNPYKPPGPPSPPEASAITKDSMVVTWARPVDDGGAEIEGYILEKR
DKEGVRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALY
PPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEATADEWTTCTPPTGLQGK
QFTVTKLKENTEYNFRICAINSEGVGEPATIPGSVVAKERQEPPEIELDADLRKVVVLRA
STTLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLE
NNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVVLAWEPPLIDGGAKITNYIVEKRETT
RKAYATVTNNCTKNTFKIENLLEGCSYYFRVLACNEYGIGLPAETTEPVKASEPPLPPGR
VTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSICTQVKTLEATISGLSAG
EEYTFRVSAINEKGKSDPRQLGVPVIARDIEIKPSVELPFNTFNVKARDQLKIDVPFKGR
PQATVIWKKDGQALKETTRVNVSSSKTVTSLTIKEASREDVGTYELCVSNSAGSLTVPIT
VIVLDKPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRETTSTAWHVVSQAV
ARTSIKIIRLITGSEYLFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKS
TMIVTWQVPVHDGGSQVIGYHLEYKERSSILWSKANKMLIADTQMKVSGLDEGLMYEYRV
YAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYII
ERRELPDGRWLKCNYTNVQETYFEVTELTEDQRYEFRVFAKNAADSISEPSESTGPITVK
DDVEAPRIMMDVKFRAVIVVKAGEVLKINADIAGRPLPIISWAKDGVEIEERARTEIIST
DYDTLLTVKDCVRRDSGQYVLTLKNVAGTRSMAVNCKVLDKPGPPAGPLEITGLTAEKCS
LSWGPPQEDGGAAIDYYIVEKRETSRLAWTICEGELRTTSCKVTKLLKGNEYIFRVTGVN
KYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIIER
REKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLVRAEDPV
FLPSPPSKPTIVDSGKTNITISWVKPLFDGGSPVTGYAVEYKKSDETDWKTAIQNLRGTE
FTISGLTTGGEYVFRVRSINKVGASDPSDSSDPQIAKEREEEPVFDLDSEMKKTLIVKAG
ASFTMTVPFRGRPVPNVSWSKPDTDLRTRAYIDSTDSRTSLTIENANRNDSGKYTLTIQN
ILNAASLTLVVKVLDSPGSPANITVHDITKESAVLSWDVPENDGGAPVKNYHIEKREASK
KAWVSVTNNCNRLSYKITNLQEGAIYYFRVSGENEFGVGVPAETKEGVKITEKPSPPEKL
GVTSVSKDSVSLTWLKPEHDGGSRIVHYIIEALEKGQKNWVRCAVVKSTHHVISGLRENA
EYFFRVFAENQAGLSDPRELLLPVLVKEKLEPPEIDMKNFPSHTVYVRAGSNLKVDIPIS
GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESIAADAGRYEITAANSSGTTKAF
INIVVLDRPGPPTGPVVISDITEQSVTLKWEPPKYDGGSQVTNYIVLKRETSTAAWTEVS
ATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTHV
TRESITVSWHEPVSSGGSAVTGYHLEMKDRNSILWQKVNKMVIRTTHFKVTTISAGLIYE
FRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITG
YIIERRDLPDGRWAKASFTNVTETHFTVSGLTQNSQYEFRVFARNAVGSISNPSEVVGPI
TCVDSYGGPVIDLPLEYTEVVKYRAGTSVRLRAGISGKPEPTIEWYKDDKELQTSALVCV
ENTTDLASILIKETNRLNSGSYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAE
KITLLWQPPADDGGARITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYVFRVR
AVNKYGIGDPLESHPVVAKNAFVTPGPPSVPEVTKITKNSMTVVWSRPVADGGSEISGYI
LEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCALNAAGHGPFSEPSDFYKAA
DPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVAMRQGEEEEWTVVSAKGE
VRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPIEMTEPAQAKDILEEPEIDLDVALRTSI
IAKAGEDVHVFIPFKGRPPPTVTWRKDEKNLGSDARYSIQNTDSSSLLIIPQVTRNDTGK
YILTIENGVGQPKSSTVNVKVLDTPAACQKLQVKHVSRGTVTLLWEPPLIDGGSPIINYI
IEKRDATKRTWSSVSHKCSSTSFKVTDLSEKTPFFFRVLAVNEIGIGEPCDTTEPVKAAE
VPAPIRDLSVKDSTKTSVTLTWTKPDFDGGSVITDYIVERKGKGEQVWSHAGITKTCEIE
VSQLKEQSVLEFRVSAKNEKGLSDSVTIGPITVKELVITPEVDLSEIPGAQVSVRIGHNV
HLELPYKGKPKPSISWLKDGLPLKESERVRLSKTENKLTLSIKNAKKENGGKYTIILDNA
VCRNSFPITIITLGPPSKPKGPIRFDEVKADSVIMSWDVPEDDGGGEITCYSIEKREASQ
TNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSEPLVSNLIVARHQFRIPGPPG
KPVTYNVTSDGMSLTWDAPVYDGGSEVTGYHVEKKERNSILWQRLNTSPISGREYRATGL
MEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRD
GGSKIVAYSIEKRQGSDRWTRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPS
QSSGVIMTRDENVPPIVEFGPEYFDGVTIKSGENLRIKALVQGRPVPRVTWFKDGEEIEK
KMKIEITDVLGSTSIFVRDATRDHRGVYTVEAKNASGSTKAEIKVKVQDTPGEPVGPIRF
TSITGEKMTLWWDAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEGHSYTASKLITGNE
YQFRVSAVNKFGVGRPLDSDPVVAQIQYTIPDAPGTPEPSNITGNSITLTWTRPESDGGN
EIQQYILERREKKSTRWVKVISKRPICETRFKVTGLTEGNEYEFHVMAENAAGVGPASGI
SRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWH
KVNVEACVKTRYTVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLTAPELDIDA
NFKQTHVVRAGASIRLFIAYSGRPTPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCNRN
DAGKYTFTVENSSGSKSITFIVKVLDSPGPPGPITFKDVTRGSVTLMWDAPLLDGGARIH
HYVVEKREASRRSWQVVSEKCTRQILKVNDLVEGVPYYFRVSAENEYGVGEPYEMPEPMV
ATEQPAPPKRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTKQL
TFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKA
GSTFTIDVPISGRPAPRVTWKLEEMRLKETDRVSITTTKDRTTLSVKDSMRGDSGRYFLT
LENTAGVKTFTVTVVVIGRPGPVTGPIEVSSISAESCVLSWAEPQDDGGTDITNYIVEKR
ESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPVIAEHPFVPP
SAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWVKENKVPCLECNYK
VTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGRPEVTDVTRSTVSLIWSA
PVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNA
AGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIW
TKGDKELELCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKSVSVVVKVLDSP
GPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYLVERRETSRLNWVIVEGECPTLSHVV
TRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWT
KPESDGGNEIRNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAA
GNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIIGYVLEMQ
EKDTDQWYRVHTKATIRNNEFTVTDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPVERL
EIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKKGIDLASRAIIDTTESYSL
LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP
TIDGGAPVSNYIIEKREAAMRAFKTVTTKCSKTLYRISGLIEGTMYYFRVLPENIYGIGE
PCETSDAVLVSEVPLAPTKLDVVDVTKSTVSLAWEKPLYDGGSRLTGYVLEACKAGTERW
MKVVTLKPTILEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTIQDLKVLPTIDLS
TMPQKTVHVPAGRPVELVIPIAGRPPPTASWFFAGSKLRESERVTVETRTKVAKLTIRET
TIRDTGEYILELKNATGTTSETIKVIILDKPGPPTGPIKIDEIDATSVTISWEPPELDGG
APLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLIEGNEYVFRVAATNRFGIGSYLQSE
VIECRSRISIPGPPETLQIFDVSRDGMTLTWYPPEDDGGAQVTGYIVERKEVRADRWVRV
NKVPVTMTRYRSTGLIEGLEYEHRVTAINARGSGKPSRPSKPTVAMDPIAPPGKPQNPRV
TDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQGA
EYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGICVRQGGVIRLTIPIK
GKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRDDSGTYDLVLENKCGKKAVYIK
VRVIGSPNTPEGPLEYDDIQARSVRVSWRAPADDGGADILGYILERREVPKAAWYTIDSR
VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDV
TKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQ
FRIIAQNDVGLSETSPPSEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKE
ILGYWVEYRQSGDSAWKKSSKDRIKDRQFTVGGLLEATEYEFRVFAENETGLSRPRRTAM
SVKTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKM
SSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGA
VGSTLRLHVMYIGRPIPAITWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYK
VQLSNILGTVDTILDVEIQDKPDKPTGPIVIEALLKNSVVISWQPPADDGGSWITNYVVE
KCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSP
FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTDEIRE
TVFSVQNLIEGLEYEFRVKCENLGGESEWSEVSEPVTPKSDVPIQAPHFKEELRNLNVRY
QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQ
VRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVISIKIPFSGKPDPVITW
QKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV
PDPPRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVEKCATTAERWIRVGQARETRYTV
INLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETREVSMTKASH
SKTKELYEKYMIAEDLGRGQFGIVHRCIETSSKKTYMAKFVKVKGTDQVLVKKEISILNI
ARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEF
LHSHNIGNFDIRPENIIYQTRRSSIIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQH
DVVSTATDMWSLGTLVYVLLSGINPFLAETNQQMIENIMNAEYTFDEEAFKEISLEAMDF
VDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKDLNMVVSAA
RISCGGAVRSQKGVSVAKVKVASIEIGPVSGQIMHAVSEEGGYVKYVCKIENYDQSTQVT
WYFGVRQLENSEKYEITYADGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGV
REVYDYYCRRTMRKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRV
TWYKSGQKIKPGEDDRKYTFESDKGLYQLTINSVTIEDDAEYTVVARNKYGEDSCKAKLT
VTPHPPPTDTTLRPMFKRLLANSECQEGQSVCFEIRVSGIPPPTLKWEKDGHPLSLGPNI
EIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYVKQEFKTEEER
ERHVQRQIDKTLRMAEILSGTETVPLTQVAQEALREAAILYKPAVSTKTVKGEYRLETEE
KKEERKLRMPYEVPEPRKYKQTTVEEDQHIKQFVPMSDMKWYKKIRDQFEMPGKIDRIVQ
KRPKRIRLSRWEQFYVMPLPRITDQYRPRWRIPKLSQDDLEMVRPARRRTPSPDYYFYYR
PRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLR
YSSPQAHVKMEETKKDFRYSTYHIPTREETSTSYAELRERHAQASYRQPRQRQRIMAERE
DEELLRPVTATQRLSEYKSELDHMAREEKSRKKSRRQREVTEITEIEEEYEISKHAHRET
SSSVSKLLRRRRSLSPTYIELMRPVSELIRTRPQPAEEYEDDTERRSPTPERTRPRSPSP
VSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHAPRITLRMR
SHRVPCGQNTRFILNVQSKPTADVKWYHNGVELQESSKIHYTNMSGVLTLEILDCNIDDS
GTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEDVPQSVFPELTRTEEYAVSSFKK
TSEMEASSSVREMKSQMTETRESLSSYEHYASAEMKSAAVEEKSLEEKSTHRKIKTTLAA
RILTKPRSITVYEGESARFSCDTDGEPVPTVTWLRGGQVISTSARHQVTSTKYKSTFEIS
AVQASDEGSYSVVVENSEGKQEAHFTLTIQKARVTEKAMTSPPRVKSPEPRVKSPERVKS
PKRVKSPEPVTSHPKAVLPTETKPTPTEKVQQRPVAALPKITQSLRAEASKDTAKLTCAV
ESSVLCVKEVAWYKDGKKLKENGHFQFHHSADGTCELKILNLTESDCGEYVCEISGEGGT
SKTNFQFRGQAFKSVHEQVSSASEAKKAAQKTAESAETKKAVPKTAELIETKKTEPKAPE
PISSKPVIVTGLQDTTVSSDSTAKFAVKATGEPQPTVIWTKDGKAITQGGKYKLSEDKGA
FFLEIHKTDTSDSGLYTCTITNSAGSVSSSCKLTIKVVKDTEIQKVSTQKSSEITSQKKA
AVQEEVSQKALISEEIKMSEVKSQEKLALKQESSKAMISEKVKKSEATSLEKSIVHEEIT
KTSQASEEIRTHEIKAFSTQMSVTDGQKVTLKANIAGATDVKWVLNGVELTNSEEYRYGV
SGSDQTLTIKQAGHKDEGVLTCIGKTSQGIIKCQYDLTLSKELSDAPAFISQPRSQNVNE
GQNVLFSCEISGEPSPEIEWFKNNLPISISSNISVSRSRNVYSLEIRNASVSDSGKYTIK
AKNFRGQCSATASLTVLPLVEEPPREVVLRTSGETSLQGSFSSQSVQMSASKQEASFSSF
SSSSASSMTEMKFASMSAQSMSSMQESFVGMSSSSFMGKSSMTQLESSTSRMLKAGVRGI
PPKIEALPPDISIDEGKVLTVACAFTGEPTPEITWSRGGRKIQNQEQQGRFHIENTDDLT
TLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSI
NT seq 95514 nt NT seq  +upstreamnt  +downstreamnt
ttctttgacttctcttttgtttgtttattaaatactattgattatacaataataatcctt
tttccccacgcagagttttctagttctcttctgtctgctgagcaagaaagacttcagact
gatagctctggcattcatttatctagtagaaatgaaacacttgaacttctgtctgaacct
ccagttcattcaactaaacttgattccaaaaaggaaggcagcgtcccagttttcatcaaa
gaggtgtcaaatgctgaaataaacataggagatgtagttaaactgtctgttactgtcact
ggctttcccaagccccaaattcagtggttctttaatggagtaatgttaaccccttcagct
gactacagatttgtttttgatggtaacgatcacagcttgatcattctgttcaccaaattt
gaggatgagggagagtatacatgtattgccagtaacgaatatggacaagcaatttgtagc
gcctatctgaaaataaattccaaagccgaggggctcagagagacagaaccagaggagaaa
tctccagaaaagcttgaaggtccttgtcctccttacttccttaaggagttaaaaccaatt
cgctgtgctcaagggctccctgccatctttgagtacatggtgcttggagagcctacaccc
actgttttgtggttcaaagaaaacaagcagctttgcaccaatgtttattataccatcatt
cataatcctgatggttccggaacattcattgtcaatgaccctcagagagaagatagtggt
ctctatgtctgtaaagcagagaacgtgtggggtgagtccacctgtgccgcagagctgctc
gtgcttccggaagacacacacatgattgatgccccctgcaaagcaacgtccatgccagag
gcacctgaagattttccacagacatccttaaaggtccccacattggactcagagcaggaa
attgcagcttttgtaaaggacaccgttttgaaagcggctttaatggcagaagaaaagcag
cagctttcttatgagcatattgttaaaaccagtgaattgagcagtcaagttactttagta
gctgagcaacggcaatccacagtcatgctggagcagaagatgcccactcctgaaagcacc
agggaacatctttccatcagtggcactattcatgttcagcctcgcaaggaaccacctccc
aatttacagctacagatcgtccagtcccagaaaaccctccccaaagaagatattctaata
catcaagagcctgagtcccaggtggttctatcaggtactgaaaaaatctttccaagtgcc
atgtccatagaagaaattagtccattaacagctgagcctctgaaaactttattagctgaa
cctaaagggagttatccacagttgtcaatagaagaaactccagcccattcatacccaacc
tctgtgactgaggaagtacttttaccaaaagaaaagacagtgtccacagtggagaaagag
caaagagtgactcttcaaaaaccagaggcacaaagtgctctcatcctggagcggagctta
gctgagggtcacgtggaaagaatccagggtcctgacgtcctgatctcccaggtcccttca
gaacacacgggcacagaagatgaaatcttgatggaaagtgctgatcaactagacagtgca
gggcaagattttgcagccagggttgaggaaggcaagtccttaaggtttccgttagcatgt
gaggaaaagcaggtactgctcaaagaagagcattctgaccactgggcaatgcccccgaac
caaaccactgagtacacaaaagagcccatggcgatccatggtgtgcaggaggtgcaggga
agtgacattctttctaaggaaagtttgctttctggtatcccagaagagcaacgactacac
ctgaaaactcagatccgcagagctttgcaagcagcagtggccagcgagcaactgagtctt
ttctctgaagggttaagaaacattgaaaaggtggaggtcaaggccataaacttcacccaa
gagcccaactgcattatgtgcacctaccttattacgtcagtgaagtctctgactgaagaa
ttaaccatcattctggaaggcattgatcctcaaatggctaacttgaaaactgaacttaag
gatgctttgtgctctctaatatgtgaggaaatgaacatcttaacagctgaggagcctaga
gttcagaaaggagaccaaacaggcttgctggaagaaatgggtactttttcagagccacag
aaggttgacacgatcacggagccagaagttgaatctaaatatctggtctcaacagaagag
gtcagttactttcatgtggaaagtcaggtcaaagctgtgacgaccgcaactacttccact
gccatctctggtgagaagcagggtgggatcccaaaaccatcagaggaaaaagagaaatcc
tctgaaggtgatactgaggaggaggttggcccagtagagatccaggaagctgagggtggc
ttcctcagggaggatggtcctgttgtacgtacgcccttggtggacaccatggctgaggaa
ggcaacactgtaagcctcacgtcatccataacagatgccagagaggtgaactggtatttt
gagagtaaactggtgccttcagatgaaaagttcaagtgtttacaagatcaaaacacatat
acgctagtcatcgaccaagtcaatacagaagaacatcaaggagagtatacgtgtgaggcc
ttgaatgaccacggaagagcagcgacttcagcaaaactcactgtagtcaaaagagctgcc
ccagtgatcaggaggagaattgagcccctggacgtagccctgggccacctcgccaaattc
acctgtgagatccacggtgcccccaatgtccggttccagtggttcaaagctggccgagaa
atctacgagagtgacaagtgttctattcgatctgcaaattatgtctccaccctggaaatc
ctgagaacccaggctgttgactgtggcgagtacacctgccaagcttccaacgagtacggc
agtgccagctgcacagccacgctgactgtgacagaggcatatccaccaacctttttctcc
agacctaagtccgttacaacttttgtgggtaaggcagccaagttcctctgcacagtgaca
gggactcccgtgatcgaaaccatttggcagaaagatggtgttgccctctcgccttcccct
cactgcaagatttcagatgtagacaacaaacacattttagaactctcaaatcttacaatt
caagatagaggggtttactcctgtaaggcttctaacaagtttggagctgacatctgccaa
gctgagttgaccataatcgacaaaccgcatttcattaaagagttagactctgtacaatca
gctatcaataagaagatccaccttgagggccaagtagatgaagacagaaaagtcacagtg
acatggagtaaaaacgggcagaaactcccccctgggaaagactataagatctattttgaa
gataaaatagcatcacttgagatccctctggccaagctaaaagattcaggaacctacgtt
tgcacagtttccaatgaagctggaagcagctcttcttcagcaacagtgactatcagagag
ccaccatcctttgtgaagaaggtggatccctcttacctaatgctcccaggtgaatcagca
cgcctgcactgtaagctgaaaggctcacctgtgatccaggttacttggtttaaaaataac
aaagaacttaccgagagtaacacaatccgaatgtcttttgtcaattcggaggctgtgctc
gatattacggatgtcaaagtggaagacagtggcacttactcgtgcgaagcagtgaatgac
gtgggcagtgacagctgcagcgctgagatagttatcaaagaacctccttctttcatcaaa
actcttgagccagcagatatagtgagaggaacaaacgccctccttcagtgtgaaatctca
ggcacaggaccatttgagattagctggttcaaggataagaagcaaattcgaagtagcaaa
aagtacaggttgttttctcagaagtctctcgtgtccctggagatattttctttcaatagt
gcggatgttggggaatacgagtgcgttgttgccaatgaagttgggaagtgtggctgcatt
gcaacccacttattaaaagaaccacccacctttgtcaagaaagtagatgactttactgca
ctagcaggacaaaccgttaccttacaagctgccgtgagagggtcagaacccatttctgtc
acttggatgaaaggacaagagatcattaaagaagatggaaaaatcaaaatgagcttttcc
agtggtgttgcagtcttgataatccctgatgtgcagattagttttggtggcaaatacaca
tgcctggctgaaaatgaagccggaagccaaacatctgttggggaattaatagttaaagaa
cctgccaaaatcattgagagagcagaactgatccaggtgacagcaggagacccagccacg
ctggagtacaccgtcacaggcaccccagaacttaagcccaagtggtataaagatgggaga
cctttggttgccagtaagaagtatcgactaagttttaaaaacaatgttgcccaactcaaa
ttttattcggctgaactacatgatagtggccagtacacatttgagatttccaatgaagtg
ggcagcagctcctgtgagacgactttcactgtactagatcgagacattgctccgtttttt
accaaacccctacgcaatgtggatagcattgttagtggtgcctgcaggctggactgcaaa
atcgctggctccctccccatgagggtgtcttggtttaaggacggtaaagaagtagctgcc
tctgacagatacagaatagcctttgtggaaggcacggcctctttggagataagcagagta
gacgtgaacgacgcagggaatttcacctgccgagccacgaattccgtgggcagcaaagac
tgcagcggggccctgattgtgcaagaaccacccagttttgtaaccaaacctgcgtcaaag
gatgttctgcctggctcagttgtttccctgaaaagcaccttccaagggtctgctcctctc
acagtcaaatggtttaagggtgacaaagagctggtttctggtggaagctgctatatcacc
agagaagcctttgaaagttccctggaactctatgtagtcaagacctctgattcaggcaca
tatacctgtaaagtcagcaacgtggccggaaccatggagtgcagtgcaaacttatttgta
aaagaacctgccacatttattgaaaaattagagccatcacagctgttaaagaagggagat
gccacccagctagcctgcaaagtaacgggcacccctccaattaaaataacatggttcgtg
aacgatagggaaattaaggagagcagcaaacacaaaatgtctttcgtggagtccactgcg
gttctaacacttacagatattgccgttgaagacagtggtgaatatatgtgtgaggctcag
aatgaggccggcagtgaccactgtggtagcattttaatagtcaaagagtcaccttacttt
accaaggaattcaagccccttgaagtgctgaaggagtatgacgtcatgttgctggccgag
gtggcaggcacgcctccctatgagatcacttggttcaaagataatacaacactgcgaagt
ggtagaaagtataaaaccttcattcaggaccagctggtgagcctgcagatcctcaagttt
gtagccgcagacgtgggcgagtaccagtgtcgggtgaccaacgaggtgggcagtgccacc
tgcagcgccagggtgactttaagagaacccccagcctttgtaaagaagattgaaagcacc
agctccctccgaggaggcacggctgccttccaggccacgctgaagggctccttgcccatc
atggtgacttggttaaaagacaacgatgaaatcaccgaagatgagaacataagaatgacc
tttgagaacaatgtggccagtctgtacctcagtggcattgaagtcaagcatgatgggaaa
tatgtctgtcaggccaaaaatgatgcaggcatacaaaggtgttctgcgttactttcagtg
aaagagcctgccaccatcatcgaggaggctgtgtctatagatgtcacccagggagaccca
gccactttgcaggttaaattttcagggaccaaggagattacagccaaatggtttaaagat
ggtcaagaactgaccttgggccaaaaatataaaattagtgtcactgagacggtctctata
ctgaagattatttctacagaaaagagagatagtggagaatatactttcgaagtccaaaat
gatgtcgggaggagcagctgcaaggctagcattaatgtgttagatcttatcatacctccc
tcattcaccaaaaagctgaagaagatggacagcatcaaagggtcctttattgacttagaa
tgcatagtggctgggtcacatcccataagcatccagtggttcaaagatgaccaggaaata
acagctagtgaaaaatacaaattctcttttcatgacaacactgctttcttggaaatcagt
cagctggaaggcgcagacagtgggacctacacctgttctgccactaacaaggcaggccac
aaccagtgcagtggccgtctgacagtcaaagaacccccttacttcatggaaaagccacag
tcacaagatgtgaatcccaatacaagggttcagttaaaggcgctggtgggtggcactgcc
cccatgacaatcaagtggtttaaagacaacaaagagctgcactcgggagcagctcgctca
gtttggaaggatgacacctccaccgttctagagctcttttcagccaaagctgccgattcg
gggacctacatttgccagttaagcaacgatgttggcacagcagccagtaaagccactctc
tttgtcaaagaacctcctcaattcattaagaagcccagcccagtggtggtgctgaggaac
ggacaatcaacaacatttgaatgccaaatcacaggcactccagaaatcagagtttcttgg
tacctggatgggaatgagataacagccatcaagaaacatggcatttccttcatcgatggt
ttggccactttccaaatttctgatgccagggtagaaaatagtgggacgtatgtctgtgaa
gctcgtaacgatgcaggcacggcaagctgcagcattgaattaaaagtgaaagaacctccc
acctttatcagggagctgaggcccgcggaagtagtcagagacagtgatgtggagctggag
tgtgaagttatgggaacggctccgtttgaagtcacgtggctgaagaacaacagggagatt
cgaagcagcaaaaagtataccctgactgacagagtgtcggtgtttaatctcagtataaac
aagtgtgacccttccgacactggcgagtaccagtgcattgtgtccaacgagggcggcagc
tgctcttgcagcgctcgagtctctctgaaagagccgccatcattcgttaggaagatagaa
aatgtcacgactgttttgaaaagctctgccacctttcagagcacggtggcgggctcacct
cccatctctatcacctggctaaaggacgatcagattcttgacgaagatgataatgttcat
gtttcatttgtgaacaatgtggccacacttcaagtcagatctgtggataacgggcacagc
ggaagatacacatgtcaagccaagaacgagtcaggcgttgagaggtgttacgccttcctt
ttagtacaagagcctgctcagatcctagagaaagctaaatccgttgatgtcactgagaaa
gacccagtgactttggagtgtgttgtggccggaacgccagaactcagagtgaagtggctt
aaagatgggaaacaaattgtgcccagtaggtatttttcgatgagttttgaaaataacgtg
gccagttttaggatccagtcagtaatgaagcaagacagcggagagtacactttcaaggtg
gaaaatgactttggaagcagcagctgtgacgcctacctgagagtgctagatcaagatatt
cctccatcgttcaccaaaaaattaaccaaaatggataaagtcctgggctcttccattcat
atggagtgcaaggtttctggctcccttcccatcagtgctcagtggtttaaggatggaaaa
gaaataactacaagtgcgaaatacagacttgtctgtcacgagaacactgtgttgctggat
gttaataacctggaattagaagatactgcgaattacacatgcagggtcacaaatgttgca
ggggacgatgcatgcagtggcatcttaactgtaaaagaaccaccaagcttcctagtgaaa
cctgagcgacaacaagccgttcctgattctacagtggaatttaaagcagtactaaaagga
accccaccattcaaaataaagtggtttaaggatgatgtggaacttgcctctggacctaaa
tgtttcattggcttggaagggtcaactagcttcttaaatctctactcggtggatgcttcc
aagactggacagtatacttgccaagttaccaacgatgttggtagcgactcttgcactaca
atgttgcttgtaacagaaccaccgaagtttgtaaagaaattagaagcattcaaaatagtg
aaagcaggtgactcagcacgacttgaatgcaagataactggatccccagaaatcagagtt
gtgtggtacagaaacgaacatgagctcccacccagcgataagtacagaatggctttcatt
gactcagtggccgtcttacagatgaactatcttggtactgaggacagtgcagacttcatt
tgtgaggctcagaatcctgctggcagcaccagctgcagtaccaaggttatagtaaaagaa
ccacctgtctttagcagcttccctcctgtggtagaaacccttaaaaatactgaagttact
cttgaatgtgaacttgcgggaacaccaccatttgaggtggtgtggtacaaagataagcgg
caactccgaagtagcaagaaatacaagattgcatccaaaaatttccacgcaagtattcac
atcctcagtgtggacacttcagatattggtgaataccactgcaaagcacagaatgaagtg
ggaagtgatacttgcgtttgcactgtaaaattaaaagaaccaccaagatttgtctccaaa
ctgaacagcctcacggttgtagctggtgagcctgctgagttacaagcaaccatagaaggc
gccccgcctatttctgtccaatggcttaaagataaggaagaagtggttagagaaagtgaa
aacaccagaattacatttgtggaaaatgttgcaactctgcagtttacaaaagcagaacca
gctgacgctgggaagtatatctgccaaatcaagaatgacggtggagtgagggagaacatg
gccacactgactgtcttagagcctgcagtcattgttgagaaggcaggaccgatgacagtg
actgtaggggacacttgcactctggagtgtaaggtggctggcactcctgaactctcagtt
gagtggtacaaggacggaaagctgttgaccagcagccaaaaacacaaatttagcttctac
aacaaaatctcttccttaaagattctctccatcgagaagcaggatgcaggcacatacacg
ttccaggttcaaaacaatgtgggaaaaagcagctgcacagctgtggttgatgtttcagac
cggatggttcctccctctttcacacgaagattgaaggatactgttggggtgctgggtgca
tcttgcatcttggagtgcaaagtggctggatcatcgcccatctctgttgcctggtttcat
gagaaaaccaagattgtcagtggagcaaagtaccaaaccacattttcagataatgtctgc
acattgcagctgaactctctggactggtcggatatgggcaattacacatgcgtggctgct
aacgttgctgggtctgacgagtgccgtgcagtgctggccgtacaagaaccaccctctttt
gtgaaggagcctgaacctttggaagtactgccaggcaaagacgtcaccttcacaagtgtt
attagaggaacccctccattcaaggtcggctggttcagaggtgccagggaactggtgaaa
ggagacaggtgcaacatctattttgaagacaccgtggcagaactggaattatttaatgtc
gacataggtcagagtggggaatacacctgtgtggtttctaacaatgctggccaaacatcc
tgcactacccatctctttgtaaaagaaccagctgcatttgtgaagaagttaagtgatcac
tctgtggagccagggaggtccatcattctggagagcacctatactggaacacttcccatt
tcagtcacctggaaaaaggatggttttaacataagaccatctgaaagatgcagcatagtc
acaacagagaagacttgcatcctggaaattctgaacagcacaaaaagggatgcaggacag
tatacctgcgagattgaaaacgaggcaggaagcgatgtttgcaaagctctggtatcaaca
ttagaacctccttattttgttacggaactggagcctctggaagcatcagtgggagattcg
gtctctttacaatgccaggtcgctgggacaccagaaatcacagtgtcttggtacaaagga
gacaccaagttacggccaactcctgaatacaggacctattttacaaacaatgtggccaca
cttgtttttaataaagtggctatcagtgacagtggcgagtacacgtgtaaagcagaaaac
agcataggaactgccttttctaagactgtcttcagaattcaagagcgccagctcccacct
tcctttgcgagacagttaaaggacgttgagcaaactgttgggttaccagttacactcacc
tgtcgcttaaacggctccgcgcccatccaagtgtgctggtatagagacggggtactgcta
cgagatgatgaaaatctacagacatcgtttgtagataatgtggcaactttaaaaattttg
cagacagacttgagtcactctggccagtactcctgttcagcttctaatccacttgggaca
gcatcttctagcgcacgactgacagcaagagaacctaagaaatctcccttctttgacatc
aagcctgtgtctatagatgtcattgctggggaaagtgctgactttgagtgtcacgttact
ggtgctcaaccaatgcgaatcacttggtcaaaagacaacaaggagattcgtcctggagga
aactatacaattacatgtgtgggaaacactccacacttgagaattcttaaagtaggcaaa
ggagactccggtcaatatacctgccaagcgaccaatgatgttggcaaagacatgtgctca
gctcaactcagtgtaaaagaacctccaaagtttgttaagaaattagaagcttcaaaaatt
gcaaagcagggagaatccatccaactggaatgtagaataagcggttcccctgaaattaaa
gttgcatggttccgaaatgacagtgaactccatgaaagctggaaatacaacatgtccttc
gtgaattctatggccttgcttaccatcagtgaagccagcaccgaggacagcggggactat
atctgtgaggctcataacggtgttggggacaccagctgcagcacagcactgaccgttaaa
gcacctcctgttttcatccagaagccttccccagtaggagcccttaaagggtctgatgtt
gtcttacaatgtgaaatttcgggaactcccccatttgaagtggtgtggattaaagatcga
aagcaaattcgaagcagcaagaaatttaaagtcacttcgaaaaattttgatacaagtctt
catatccttaatcttgaagcctctgatgtgggagaatatcactgcaaagctgccaatgag
gtggggagtgacacgtgtgtttgcactgtcaagttcaaagaacccccacgatttgtgaaa
aagctaagtgacacctcaacccttattggggatgctgttgaattacgggccgtagtggaa
ggtttccagcccatttctgttgtttggctgaaagataaaggtgaagtcatcagagagagt
gaaaacacgaggatttcgttcgttgataacgttgcaaccctccaacttgggagcccagaa
gcatctaattctggaaaatacatttgccaaatcaaaaacgatgctggaatgagagaatgt
tcagcagtcttgactgtactagaaccagccagaatcatagagaaaccagaacccatgact
gtcactactggaaacccttttgcactagagtgtgtggtgactggaacaccagaactttca
gccaagtggttcaaagatggaagagaattatctgcagacagcaaacaccacatcacattt
gtcaacaaagtggcttcacttaaaatcccttgtgcagaaatgagtgacaaggggttatat
agctttgaagtaaaaaacagtgtcggtaaaagtaactgcactgtatctgtccatgtttcg
gatcgagtcgtgccgccttccttcatccgtaagctgaaagacatcagtgccatcgtgggg
gcctcggcggttttggagtgtcgagtctctggctcagcccccatttccgttggctggttt
caggatggaaatgagatcattagtgggcctaaatgccagtccagcttttcagaaaatgtc
tgtgctttgaatctgagcttcttggagtcctccgacacaggcatatacacgtgcgtggcc
gccaacgtggccgggtctgacgaatgctcagcagtcctgactgttcaagaaccaccatct
tttgaacaaacccctgattctgtcgaagttctgcctgggacgagcctcacgttcaccagt
gtcatcagaggcaccccgcctttcaaggtcaagtggttcaaaggcagccgcgagctggtg
tcgggggagtcatgcagcatctctctggaggactttgtcacggaactggacttgtttgag
gtggagccgttgcaaagtggagactattcttgcctcgtgactaacgacgcgggcagtgct
tcctgtaccacacatctttttgtgaaagaaccagccacctttgtgaaaagattggctgat
ttcagtgtggagacaggaagccccatagtccttgaggccacatacactggcacacctccc
atctcggtgagctggatgaagaatgagttcccccttacacagtctcagaactgcagtatt
accatgacagaaagatctacgatcctggaaattctcgacagcacaatagaggattatgca
cagtacagctgcctgatagaaaatgaggctggtcaagatatttgtgatgctctggtgtct
gtcttagaaccaccttattttatcgaacctctggagcacgtagaagccaccattggagaa
cctgtaactttacggtgtaaagtggacggaaccccagaaattagaatttcttggtataaa
gaacacacaaagctacgatcagctcctgcatataaaatgcaattcaaaaataatgttgcc
tccttagtaatcaacaaagtggatcacagcgacgtgggagagtatacgtgcaaggctgaa
aacagcgtgggggcagtggcttcgtcatctgtgcttgttatcaaagagcgcaaactccca
ccttcctttgcaagaaaactgaaggatgttcaagagactcttggcttcccagttgcgttt
gaatgccgcatcaatggctcagaacctcttcaagtgtcttggtataaggatggggtactt
ctgaaagatgatgctaatttgcaaacatcttttgttcataatgtagcaactcttcagatt
ttgcaaactgaccacagccacgttggtcagtacaattgctcagcctctaatccttttggg
accgcttcatccagtgccaggctccttctctcagagcatgaagtgcctcctttctttgat
ctaaagcctgtatcagtagatcttgctcttggagaaagtggttcttttaaatgtcacata
actggaaccgcaccgatcaaaatcacttgggccaaagataacagagagattcgccctgga
ggcaactacaagatgactttggttgagaatactgccactctgacagttctcaaagtaggc
aaaggtgatgctgggcagtacacctgctacgcaagcaacgtcgcgggaaaagactcttgt
tctgctcatctgggtgtacaagaaccacccaggttcattaagaagctagaaccttcaaga
attgtgaaacaagatgaatacacaagatatgaatgtaaaataggcgggtctccagaaatc
aaagttttgtggtacaaagacgagactgaacttcaagagagcagtaaattcagaatgtcg
ttcgttgactcggtggctgtgttagaaatgcatgatgtccgtgtggaagacagcggagac
tacacgtgcgaggcccgcaatgcagcgggcagtgccagcagcagcacctccttaaaagtt
aaagaaccacccactttccgcaaaaagcctcatcccgttgagaccctgaaaggagctgat
gttcaccttgagtgtgagcttcagggcacacccccatttcaagtttcttggcataaagac
aagagggaacttaggagtggcaagaagtacaagataatgtccgagaacttccttacgagc
gtccacatcctgaacgtcgatactgcagacgttggggagtaccagtgtcgagccacaaac
gatgtggggagtgacacctgtgttggttccatcgctctgaaagcaccaccaaggtttgtg
aagaagcccagtgatgtttctaccatcgtgggtgaagaagttcagctccaggctactatt
gaaggcgctgagccaatttccgtgatgtggttcaaagataagggagaagttgtcagagaa
agtgatgacatatggatttcttactcagaaaacattgcaaccctccacttttccacaaca
gaaatagccaacgccgggaaatacacctgtcagatcagaaacgatgccggaatgcaagag
tgttccaccacactgtccatcctcgagcctgcagcgattgtggaaaagccagaatctatc
aaagttaccacgggagatacctgtaccttggagtgcacagtcacaggcacgcccgaactc
actaccaagtggttcaaggatggaaaagagctgacaagtgacagcaagtataaaataagc
ttcttcaacaaagtatctggcctcaagattattaacgtggcgcccagtgacagcggggta
tacagttttgaggtgcaaaaccctgtggggaaagacagctgcacagcctcagttcaagtt
tcagaccgaactgttcctccttcattcacaagaaaattgaaagagacccatggcctatct
ggttcctcggtaataatggagtgcaaagtctatggatcacctccaatctctgtctcctgg
ttccacgaaggaagtgagatcagcagtgggaggaaataccagaccaccctcacggataac
acttgtgctctgactgtgaacatgctggaagactcagacgctggtgactacacgtgcata
gctaccaacgcagctggttctgatgagtgcagtgctcctttgactgtgagagaaccacca
tcttttgttcagaaacccgagctcatggatgttttgactggaaccaatgtaactttcaca
agcattgtgaaaggaacaccccctttcagtgtcagctggttcaagggtagcagtgaaata
gtaccaggggacagatgtaatgtgtctttggaggattcagttgctgaactggagctgttt
gatgtagatgcatcacacagtggagaatatacctgcatcgttagtaacgaagccggcaaa
gcttcttacacgacacacctacacgtgaaagctccagccaaatttgtaaagaagctcaat
gattacagcatagagaaaggaaaacccctgatcctagaaggcacatatactggaactcct
cccatttcagtcacatggaagaaaaatggcataaacatagctccttcccagaggtgtaat
ataaccacaacggaaagatcggcaattctggaaattccaagtagcacagttgaggatgca
ggacagtacaactgctacattgaaaatgcttctgggaaagattcctgttcagcacaaata
ctgatcctagaaccaccatattttgtcaagcaattggagcctgtgaaggtgacggttgga
gattctgcctctttacaatgtcaacttgctgggtcccctgaaattgcagtgtcctggttt
aaaggagatacaaaattgagacccactgctacctacaaaatgcattttaggaataatgtt
gctacactggttttcaaccaggtcgatactaatgatagtggtgaatatatatgcagagct
gaaaacagtgtgggagaagtttcttcatcaactttcctgactgttcaagaacaaaagctt
ccaccatcattttctcgacaactgagagatgttcacgaaacggtcgggctgcccgttgtc
tttgagtgcgccatcagtggatcggaacctatctcggtgtcttggtttaaagatggcagg
ccattgaaagatggccccaatgtacaaacatcatttttagacaatgtagccactctcaat
attttccaaacagatcggagttttgcaggccagtattcctgcacggctacaaatcctata
ggttctgcttcttccagtgccagacttgttctcacagaggggaagaacccacccttcttc
gacatccctcttgcccctgtggatgctgtggtgggagagagcgcagactttgagtgccac
gttactgggacacagccaataaaggtcgcctgggccaaagacaacagagagatacgaagt
ggcggaaactaccagatcagttacctggaaaacagtgcccatctgacaatcctgaaagta
gacaaaggagactctggccagtacacctgctatgctgtcaatgaagtgggaaaggactcc
tgcacagctccgctcaatataaaagagcggctcatcccaccgagtttcactaaaaaactt
tcggagacagtagaagaaacagaagggaattctttcaaactcgagggccgtgttgctggc
tcccagcctataactgttgcctggtacaaaaacaatatagaaatccatccaacacccaac
tgtgaaatcaccttcaagaacaacgcacttctgctgcaagtcaggaaggcgggcgtgggc
gacgctggtctgtacacgtgcaaagtgtcaaacgatgcaggctctgctctgtgtacatct
tcaatcgtcatcagagaaccgaagaagccacctgtgtttgaccaacaccttactccagta
acagtgactgaaggagaattcatgcagctcagctgccatgtcaggggatcagaaccgatc
aggatccagtggttgaaggctggcagggaaataaagccctcagacagatgcagcttcagc
tttgctaatgggactgctgtgctggaactcaaggatgtggctaaaggagatgcaggagat
tatgtgtgtaaagcttccaacgtggctggaagtgacacttccaaatcaaaagtgaccatt
aaagacaaaccagctgctgtcccagcagctaagaaagcagcggtagacggaaaactcttc
ttcatatcagaacctcagagtatcagagttgtcgaaaaaaccactgccacattcattgca
aaagttggaggtgatccaattccaaatgttaaatggacaaaagggaaatggagacagctg
aaccaaggaggtcgcattttcatccaccagaaaggtgacgaagcaaagctggagattcga
gacaccacaaaaaccgactctggattgtaccgatgtgttgcgtttaataaacatggtgaa
attgaaagtaatgttaatctacaggtggatgagaggaagaaacaagagaaaattgaagga
gaccttagagcaatgctgaaaaagactccagccttaaagaaaggagctggagaagaagag
gaaattgatatcatggaacttctcaaaaatgttgatccaaaagaatatgaaaaatatgcc
cgcatgtacggaatcactgacttccggggtcttcttcaagcatttgaattgctaaagcaa
agccaagaagaagagacacatagattggaaattgaggaaatagagaagtcagagaaggaa
gaaagggaatttgaggagcttgtgtcatttattcagcaaaggctatcccagacagagcct
gtcactctgatcaaggacattgaaaatcagacagttttgaaagataacgatgctgtgttt
gaaattgacattaagattaattatccagaaatcaagctttcatggtacaaagggactgaa
aaactggaacccagtgataaatttgaaataagcattgatggtgatcgacatacactcaga
gtcagaaactgtcaacttaaagatcagggcaattatagattggtgtgtggtccacacatc
gctagtgctaaactaactgtaattgagcctgcttgggaacggcatcttcaggatgttact
ttgaaagaaggccagacttgcaccatgacatgccagttttctgtgcctaatgtaaaatca
gaatggttcagaaatggcagaatctttaaaccccaaggtagatataagactgaagtggaa
cataaagtccataagctgaccattgcagatgttcgagcagaagaccagggccagtacacc
tgcaaatacgaagaccttgaaacttcagcagagctcagaattgaagctgaaccaattcag
tttacgaggcgcatacagaacatcgtggtgagtgaacatcaatctgccaccttcgagtgt
gaagtgtcctttgatgacgccattgtaacatggtacaaagggccaacagaactgaccgag
agccagaaatacaactttaggaatgatggtcggtgccattatatgaccatccacaacgtg
accccagatgacgaaggtgtctactcagtaattgctcgactggagccgagaggtgaagcc
agaagcacagcagagctgtacttaacaactaaagaaatcaaacttgagatgaagcctcca
gacattcctgattccagagttccaatccccaccatgcctatcagagcggtgccaccagaa
gaaattcctcctacggctgttcctcctatccctctgttgctaccattacctgaagaaaag
aaaccaccagcaaaacgtattgaagtgaccaaaaaagctgtgaagaaagatgctaaaaga
gtcgcaaagcccaaagaggcaccacctgaagtcccagaggttgccaagaagcccccacct
cctactgctttaattccagcaaaagctgctgaaattatcgatgtatcctctaaggcggaa
gaagtgaaaatcacaaccataaccagaaagaaggaggttcagaaagaaaaagaagctgtg
tatgagaaaaagcaagcagtctatgaggagaagagacttttcatagaatctgtggaagaa
ccttatgacgaactagagatggaaccatacacagagccatttgaggaaccttattatgag
gaaccagatgaagactatgaagagaccaaggtcgaagctgaaagggaagttcacgaggaa
tgggaagaagattttgaagaagggcaagaatactatgaaagggcagaaggttatgacgaa
gaggaggaagaatgggaagagacttatcaagaaggagaggtcatccaagttcaaaaggag
gtttatgaaggagtgtattcattggaatcacaagagaggaaaattccagcaaaagtgccc
gaaaagaaagcagcaccacctcctaaagttgtaaagaagcccatagttgaaaaaattgaa
aagacttctcgaagaatggaagaagaaaaagttcaagtcaccaaagtacctgaagtttca
aagaagattgttccacaaaaaccttctcggactccagtgcaggaagaagttattgaagtg
aaagtaccggctgtacatacaaagaagatggttatttcagaagaaaagatgttccttgct
tctcacacagaggaggaggtgtcagtcacagtccccgaagtacaaaagaaaatcattacc
gaagagaaagttcacgtcgctgtttccaaaaagactgagcctccacctaaagtccctgag
ccacccaagaaaccagtcccagaagaagtggtccctgttcccgttcctaaaaaggtggaa
cccccaccagccaaagttcctgaagttccaaagaaacctgtgccagaggagaaaaagcca
gttcctgtgcccaagaaggaacctcccgctcccccgaaagtcccagaggtgaccaagaaa
cctgtccctgaagaaaaggttcctgttcctgttccaaagaaaaaggaagctccaccagct
aaagttcctgaagtacagaagagggttgtcacagaagaaaaagtaaccgtcatcactgaa
agagaggaatctcccccaccagcagtgccagaaataccaaagaagaaagttcccgaagaa
aaaagacctgttcctcggaaagaggaggaagttccaccaccaaaagtgccagctctgccc
aagaaacctgtcccagaggagaaagttcctgtgccagttcctgtcgctaagaaagcccct
cctccccgagctgaagtttctaagaaaactgtcgtagaagaaaaaagatttgctgctgag
gaaaaactatctgttgcagttcctcaaagagtggaagtcatgcggcacgaagaggaggaa
tggagttactcaaaagaagaggaaagaatatccgtttcagtttatagagaagaggaaaga
gaggaggaggaggaggaagtggaggttacagaatatgaagtgatggaagagcctgaggaa
tatgtggtggaagaagaagagctgcacttggtttctgagagggtggaagccgaagcagtt
gaagtgcctgagaagaaaattgtacccaaaccgaaaattccggctaaaatagaagagcct
ccaccagctaaagttcctgaagtacctaagaaaattgtgccagaaaagaaaattcctgct
gcagttcccaaaaaggaaaaggtgccccctgccaaagtgccagaagagccaaagaaacca
gttcctgagaaaagggctcctcccaaagtggctaagatagaagaacctcctcccaccaaa
gtgactgagaggcacatgcaaattacccaggaagaaaaagttcatgttgctgtcactaaa
aaagtggagcctccaagaccaagagtgcccgaggaacccaagagagctgttccagaagaa
aaagttccaaaactcaaacctaaaaaagaggaggaaccaccagccagagtgactgaactc
aggaaaagagctgttaaagaagaaaaggtatccattgaagttccaaaaagagagcctcat
gttgctaaagaagtaactgtaacagaagagaaagaatggtcttatgctcgagaagaagaa
gtacaacgggaagaggaatatgaagactatgaagaatatgattataaagaatttgaggag
tacgaaccaacagaagagtacgagcagtatgaagagtatgaggaacgcgaagtcgaacat
tatgaagagtacatcacagaacctgagaagcccatcccagtaaagcctgtcccagaagaa
ccggttcccaccaaaccaaaggccccaccagctaaagtgccgaagaaagctgtccctgaa
gaaaaagtaccagtgctcattcctaagaaactcaaacctctaccgcccaaagcacctgaa
gaagcaaagaaagttgttgaggaaaaaatacacatttcaattaccaaacgtgaaaaagag
caggtgactactgaaccagctgctaaagtgcccctgaagcctaagagggttgtcacagaa
gaaaaagtacctgttcctaaaaaagaagtagcagcacctgttaaagtgccagaagtacct
acaagagaagaagaaccagaagagattgcctttgaagaagaagttgtcacccaagtagag
gaatattttgaagaagaagaagagtaccttcatgaggaagaggaaatcgtaactgaagaa
gaagtggtaccagtgataccagtcaaagtgcctgaggtacccaagaaacctgttccagaa
gagaagaagcctgttcctgttcccaaaaagaaggaagccccaccagcaaaagtgcctgag
attcctaagaagccagaggagaaagttcctgtgcccattgctaaaaaagagaaggctcca
ccagctaaagttcctgaggtacccaagaaacctgtaccagaggagaaggtgccagttcca
gttcctaaaaaggtggaagctccacctgccaaagtgccagaagtccccaagaagcctgtg
cctgagaagaaggtgccggttcctgctcctaagaaagtagaggctccacctgcaaaagtg
ccagaggtgcccaagaagatcatcccagaagaaaagaagccaacacctgttccgaaaaaa
gtggaagctccaccacccaaagtgccgaagaaacgcgagccagttccagttcctgttcct
gtagctctgcttcggaaggaggaagttacatttgaagaagaaattgttcttgaagaggaa
gttctccctgaggaagaggaagttctccctgaggaagaggaagttccccctgaggaagag
gaaattctacctgaggaagaggaagttccccctgaggaagaggaatttccaccagaggag
gaagaagttcctcctgaagaagaagaaattcctcctgaggaagaagaatttgtacctaaa
gaagaagttcttccagaaattaaacctaaggtgccagtacctgcacgagtgcccgaagta
ccaaagaaacctgtaccagagaagaaagtccctgttccagctcctaaaaaagtggaacct
ccaccacccaaagtgcctgaagttaagaagaaagtgccagagaagaaagtgattgttccc
aagaaagaggaggctcctcctgccgcagtgcctgtggtgcctaagaaacctgaaccagaa
aagaaggtgcctcctccagctcttaagaaagcagtggctcctcctgccaaagaacctgaa
gtgacaaagaaaccagttcctgaagtacccactgctcctcctaaaaaagtagaggctcca
gcagtaaaagttcctgaggtacctaagaaagtggaagaaaggcgaatcattgtccccaaa
gaagaggaagttccaccagttgaagtgtttgaggagcctgaggagcctgaggagcctgaa
gagcctgaagagcctgaagagcttgaagagcttgaagagcctgaagaacctattccagaa
gaagagatcccagaggaaccaccgagcatagaggcgattgaggaggtggcgccacctaga
gtgcctgaagtggttaagaaagcagtacccgaagcacctactcctgttcctaaaaaagtg
gaggcaccaccagctaaagtgccaaagaaggttgctgaagaaaaaatacctgttcctgtt
cagaagaaggaggcccctccagccaaagtgcctgaagtacaaaagaaattcccagaaaag
aaagtcccagaaaagaaaatcccagaaaagaaagtccctgaaaagaaagtccctgtgcct
aaaaaagaagctgttcccccagctaaagggagaactgtccttgcagaaaaaatatcagtt
gctttccacaaagaggaagtagtagaggaaagaacagagttcgaagtagtggaagcccaa
gtggaagaagctcttgaagaagaagagttccgtgaggttgaggaatattttgaagaagaa
gagttccatgaggtagaagaattcgtcaaagtagaagagtatagagctgaagaagttcac
agagctgaagaagtccatagggtaatagaagtcttagaggctgaagaagtggaagtatat
gagaaacccaaagctccacctaaagggcctgagatatccgagaaaatcatccctccaaaa
aaaccacctactaaagttgttcctcgaaaagagccaccggctaaagtacccgaagtaccc
aagaaaattgtggtggaagaaaaagtgcgtgttcctgaggagcccaagatcccaccagct
aaagcacgtgaagtacccaagaaaattgttccagaagaaaaagttcgtgaagctgttccc
aaagagcctgaagtcccacctgctaaagttcttgatgaagttcttgaggtgcataagaaa
agtattcaagaagaagaatcacctatagttctttctgaagatgcaacgatatacatttat
gaagtatctgaagaatcaactctggaagaaaaagtacttgtgactcatcctcaaaagaca
aaaaccaaactagcaaaagtgcctgaaacacccaagaaagttgttccagaggacaaaata
tatgtgactatgcctaaaaagagggaaacaccgacaactaaagagcctgatacaaccaga
gacgtttttccagaggtggagtctactgaggctgttcccaaaattccagagcatcctcca
actaaagagttagaagtctccaaggaaggtgttccagcgagacaagctcctgttaccaaa
agaagaaaaacaccaccaccaaaagtgcctgaatcacctcaagaagtcgttcctgtaaag
gaaacactcatggctgctccccctgaaattgaaacaccttccactaaagctgaagctgtg
aaagaagttgctcctgaaatgaatgtatctgaggatgttctgaaagcgccagaacctcca
cctgtgaaagtgcctgaagatgttcaagaaggtgttcctgcaaaaagagttccttccaaa
aaaagagaacctccacctgttaaagtgcccgaagctcctcaaggaattgtccctgaaaag
aagacatatgtggttcgtcacaaaaagcttgaagtccttcctgatgaagtgcctgaggct
gcagaagaagttgtctgggaagagaaattgcctcctccccaaaagcctgcagttgtatct
gtcaaagtgcctgaggctcctaaggaagttgcccccgaaaagaaagtacctgtggcacct
cctaaaaagccagaagttccacctgttacagtgcctgaggctcccaaggaagttgtccct
gaaaagaaagtgcctgtggcacctcctaaaaagcctgaagtcccacctgttacagtgccc
gaggctcccaaggaagtcgtccctgaaaagaaagtgcctgtgatgcctcctaaaaagcca
gaagtcccacctgttacagtgcccgaggctccaaaggaagtcgtccctgaaaagaaagtg
cctgtgctgcctcctaaaaagccagaagtcccacctgttacagtgcccgaggctccaaag
gaagttgtccctgaaaagaaagtgcctgtgatgcctcctaaaaagccggaagtcccaccc
gccaaagtacctgaggtgccgaaggtagctgtcccagaaaagaaggtgcctgaagttatt
cctcccaaaccggaaagtcctccttctgcagtgcccgaggtgccaccaaaggaagccatc
cctgaaaagaaagtgcctgtggctcctcctaaaaagccagaagctccacctgctaaagtt
cctgaagttcctaaagaagttgtacctgaaaagaaagtgcctgtggctgtgcccaaaaaa
ccagaagttccacctgctaaagtgcctgaagctgctcaagaagttgtcccagaaaataaa
gttcccaaggcaccacccaaaaaaccagaaaccccacctgtcacagtgcctgaagttccc
caagaggttgtcccagaaaagaaagttcccaaggcaccacccaaaaaaccggaagcccca
cctgtcacagtgcctgaagttccccgagaggttgtcccagaaaagaaagttcccaaggca
ccaccagaaagaccggaagccccacctgtcacagtgcctgaagttccccaagaggtggtc
ccagaaaagaaagttcccaaggcaccacccaaaaaaccggaagccccacgtgtcacagtg
cctgaagttccccgagaggttgtcccagaaaagaaagttcccaaggcaccaccagaaaga
ccggaagccccacctgtcacagtgcctgaagttccccaagaggttttcccagaaaagaaa
gttcccaaggcaccacccaaaaaaccggaagccccacctgtcacagtgcctgaagttccc
caagaggtggtcccagaaaagaaagttcccaaggcaccacccaaaaaaccggaagcccca
cgtgtcacagtgcctgaagttccccaagaggtggtcccagaaaagaaagttcccaaggca
ccacccaaaaaaccggaagccccacctgtcacagtgcctgaagttccccaagaggttgtc
ccagaaaagaaagttcccaaggcaccaccagaaagaccggaagccccacctgtcacagtg
cctgaagttccccaagaggttgtcccagaaaagaaagttcccaaggcaccaccagaaaga
ccggaagccccacctgtcacagtgcctgaagttccccaagaggtggtcccagtaaagaaa
gttcccaaggcaccacccaaaaaaccggaagccccacctgtcacagtgcctgaagttccc
cgagaggttgtcccagaaaagaaagttcccaaggcaccacccaaaaaaccggaagcccca
cctgtcacagtgcctgaagttccccaagaggttgtcccagaaaagaaagttcccaaggca
ccacccaaaaaaccggaagccccacctgtcacagtgcctgaagttccccaagaggttgtc
ccagaaaagaaagttcccaaggcaccacccaaaaaaccggaagccccacctgtcacagtg
cctgaagttcccaaagaagttgttccagaaaagaaagtagctgttcccaaaaagcccgaa
gtcccaccagctaaagtgccagaggtgccaaagaaacctgtcttagaagaggaaccagct
gctcctgtccccaagaaagcagagtctcctcctccagaagtctgtgaagaacctgaggaa
attgctcctgaagaggaaaagccagttcctgttgtggaagaggaggaggcagaagcccca
ccaccagtgcctgaagaacccaagaagattgttccagagaagaaagttcctgtcattaaa
gaaccagaagctccacctcctaaagtacctgcgatggcaaagaaagttgtcccagtgaag
aaagtcccaatggttaagaagcctgaaacaccagaagttaaagtgtctgagcttcccaag
agacttgttccagtaaagaaagaacctgtgcctgttaccaaaaaaccagcagtcctgcga
gaaaaagtgcctgaagttcccaaggaaatcatcacagaagagaaagtgtctgttcctgta
cctgaagaaccagaagctccacctgtccaagttgaagagtctcctgaggaaataatatat
gaagaaagagcatccataaccattggtagaaaagtgactccccctgttgaagaacgtgaa
attgagaagtacgttgagcctgaagaacctgaacctgaaccacaaccggaagaaatacca
gtacaagaacctgaacccgaaaaggttattgagaaaccgaaactcaaaccaaggccccca
gctcctcctcctgctccacccaaggaagatgtgaaggagaaaatattccaacttaaagct
gtttcgaagaagaaagttcctgaaaaaccgcaggttccagaaaaagtggagctgaaacct
ctgaaagtgcttggagctgaaaagaaagttcgcaaattacttcctgagcctaaaccagaa
ccaaaggaagaagttgttctcaaaagcgttctaagaaggagacctgaagaagaagaacct
aaagtagaacctaaaaaagtagaaaaaattaaaaaacctgcagtgccagaaccacctcca
aaacctgttgaagaggttgaagcacctccagctgctgttcccaaaaaagaaaggaaaatt
cctgaaccaacaaaagtgcctgaaattaagccagcaatacctctccctgcacctgaacca
aaaccaaagcctgaaccagaggtgaaaattatcaaaccacctcccatggagcctgctcca
gtccccatcgctgccccagtcacggtgccagtagttggaaagaaagcagaagccaaagca
cctaaggaagaggctgccaagccgaaaggtcccatcaaaggtgtacccaaaaagactcct
tcaccaatagaagctgaaaggaaaaagctaagaccaggaagtggtggagagaaaccgcct
gatgaagccccgttcacctaccagctaaaggctgtgccactgaagtttgtgaaagaaatc
aaagacattgtcttgactgaagcagagtcagttggctcctctgcaatctttgagtgtttg
gtctccccctccactgcagttacaagctggatgaaagatggtagcaacatccgggagagc
ccaaagcacagattcatcgctgatggtaaagacagaaagctgcacatcattgatgttcaa
ctctctgatgctggcgagtacacctgtgttttacgtctggggaataaggaaaagacctcc
acggcaaaacttattgttgaagaacttcctgtgcgttttgtaaaaactcttgaagaggaa
gtcacagtggtcaaaggacagccattgtacttgagctgtgagctaaacaaagagcgtgac
gtggtctggaggaaggatgggaagattgtggtggagaaacccggcaagattgttcccggt
gtcattggcttgctgcgggccctgaccatcaatgacgcagacgactccgatgccggaaca
tacacagtgactgtggaaaacgccaacaacctggagtgttcatcctgcgtgaaagtcgta
gaagtcattagagactggctggtgaaacccatacgagatcagcatgtgaaacccaagggg
actgctgttttcacctgtgttatagcaaaggatacgccaaacattaagtggttcagagga
tatgatgaaatccccttggaaccaactgacaagacagagattctgaaagatggaaatatt
ctatacctcaaaattaagaatgctacaccagaagacgttgatgaatatgcagtggaaatt
gaagggaagagatatcctgcaaagctgacacttggagaacgtgaagttcaattgcttaaa
ccaatagaggatgttaccatttatgagaaagaaagtgcaagctttgatgcagaaatatca
gaagcagatgttcctggacagtggaaactgaagggagaacttctaagaccctcacctact
tgtgaaatcaaggcagaaggtggaaaacgcttcttgactttgcacaaagtcaaattggac
caagccggtgaagttctttaccaggcacttaatgcatttacgacagccattctgacagta
aaagaaattgaacttgactttgtcgtgcccctgaaagatgtcacagtcccagaaaagcga
caggctcgatttgaatgtgtcctcactcgagaggcaaatgttatatggtctaaaggacct
gatataatcaaggcatctgacaagtttgacatcattgccgacggaaagaaacacattctt
gtcatcaacaattctcagtttgctgacgaaggggtctatactgctgaagtggagggcaag
aagacctcagcacgactatttgttacaggtataagactgaaattcatgtcgcctcttgaa
gatcaaacagtgaaagaaggtgaaacagcaacttttgtatgtgagctttctcatgaaaaa
atgcacgtagcctggttcaaaaatgatgccaaactccacacgagcagaactgtactcatc
tcatcggaaggcaagactcacaagttggaaatgagagaggtgaccctggatgatatatcc
cagatcaaagctcaggttaaggacctgagctccacagcaaatctcaaggtcttagaggct
gatccttacttcaccgtgaaattacatgacaaaactgcagtggagaaggatgagatcatc
ttgaagtgtgaagtgagcaaagacgtgccagtgaaatggttcaaagatggtgaagaaatt
gtgccttcacccagatactccatcaaatcagatggcctgcgccgcatcttaaagatcaaa
aaggcagaactgaaagacaaaggcgaatatgtgtgtgactgcggcacagacaagacaaaa
gcaaatgtcactgttgaggctcggctaataaaagtggaaaaacctctgtatggagtagaa
gtgtttgtaggtgaaacagctcgctttgaagtcgaactttctgaaccagatgttcacagc
cagtggaagttaaaaggagagcctttaactgcatcacctgactgtgaaatcattgaagat
gggaagaagcacattctggtcctttataactgccagcttggtatgacaggagaggtctcc
ttccaggctgccaatgctaagtctgcagctaatctgaaagtgaaagaattgccacttatc
ttcatcacacctctcagtgatgttaaagtctttgagaaagatgaggctaagtttgagtgt
gaagtatccagggagcccaaaacataccgttggctgaaaggaacccaggaaatcacaggc
gatgacaaaattgagctgataaaggatggcacccggcatgcgctggtgatcaaatctgct
gccttcgaagatgaagcaaaatacatatttgaagctgaagataagcataccagtggcaaa
ctgatcattgaaggaatccgactcaaattcctcactccactcaaggatgtcacagccaaa
gagagggaaagtgctgtgtttaccgtggagctgtcccatgataacattcatgtccgctgg
ttcaagaacgaccagcgccagcataccaaaaggaacatctcaatgcacgatgaagggaaa
atccattccatcacatttaaagacctctctattgatgatacctctcaaattaaagtagaa
gctatggggctgagttcagaagcaaaacttactgtgcttgagggagatccatactttaca
ggaaagcttcaagattacactggcgtagagaaagacgaagtggttctacagtgtgaaatt
agcaaagcagacgcaccagtgaaatggtttaaggatggggaggaaataaagccatctaaa
aatgctgttattaaggctgatggcaagaagcgcatgctaatcctaaagaaagccttgaaa
tcagatattggacagtacacctgtgactgcgggacagataagacctcaggaaagcttggc
attgaggatcgggaaattaaactggtgcgacccctgtacagtgtggaggtgatggagact
gagtcggcccgctttgaaaccgaaatctcagaagaggatatccatgccaactggaaactc
aagggagaggcactactccaaacacctgagtgtgagattaaggaagaaggcaaaatgcac
ttccttattctgcacaactgccgcttggaccagaccggtggggtggatttccaagctgcc
aatgttaaatctagtgcccacctccgagtaaaaccacgagtcattggtcttctgaggcct
ctgaaggatgtcacagtaactgcaggggaaacagccacctttgactgcgagctgtcttat
gaggatatcccagtggaatggtatctccgagggaagaaactagagcccggtgagaaggtg
gtcacacgttcagaaggaagagttcatacacttactctgagggatgtaaagttagaagat
gctggagaagttcaactagtagcaaaagatttcaaaacacaagccaaactcattgtgaaa
gaacccccagttgaattcactaagcctcttgaggaccagacggtcgaagaggaagccaca
gccgttttggagtgtgaagtatcacgagaaaatgctaaggtgaaatggttcaagaatgga
acagaaattctcaaaagcaagaagtatgaaattgttgctgatggcagggtcagaaaactt
attatacacggctgtaccccagaggatattaaaacatacacttgtgatgctaaggatttt
aagacttcctgtaacctgaacgtcgtgcctcctcatgtggaattcctaagaccactcact
gatcttcaagttaaggaaaaagaaatggcacggtttgagtgtgaaatttcccgagaaaat
gccaaggttcagtggtttaaagatggtgctgaaattaaaaagggcaaaaaatacgacatc
atatctaagggagccgtccgcattcttgtcgtcaacaaatgcctactggacgacgaagcg
gaatattcctgtgaagtaaggacagcgagaacttctggcatgctgacagtcctggaagaa
gaagctgtctttacaaaaaatcttaccaacattgaagttagtgaaacagacaccataaaa
ctggtttgtgaagtctccaagcctggggcagaagtggtttggtacaaaggagatgaagag
atcattgaaacaggtagatacgaactccttactgatggacggaagagaatcctgaccatt
cagaacgctcaccttgaggatgcgggcaactacaactgccgactcccaagttctcgaact
gatggcagagtcaaagtacatgaacttgcagctgaatttatctcaaagcctcaaaacctt
gagatacttgaaggagaaaaggctgaatttgtctgctctatatcaaaggaaagctttgaa
gtccagtggaagagagatgataagacacttgaatctggagataagtatgacattattgct
gatggcaagaagaggatcctcgtggtgaaagatgccactctacaagatatgggcacttac
gtagtcatggttggggctgccagagcagcagctcacttgacagtaattgaaaaactcaag
atcatagttcctctgaaggacacccgtgtgaaggaacagcaagaagtcacctttaactgt
gaggtcaatactgaaggtgccaaagccaaatggttcagaaataaagaagccatatttgac
agttcaaaatacattattctccaaaaagacctggtctacaccctcagaattagaaatgca
cgattagatgatcaagacaactacagtgtatctctgaccaatcacagaggtgaaaatgtt
aagagtgcagccaatctaatagtagaagaggaagaacttaggattgttgagcctcttcag
gatattgaaacaatggagaagaaatctgtcacgttctggtgcaaggtcaaccgtctcaat
gtaagactgaagtggacgaaaaatggagaagaggtggcttttgacaaccgtgttttatac
agaatcgataaatataagcactctctaatcattaaagactgtggcttccccgatgagggt
gaatacattgtcactgctggacaagataaatctgttgctgaccttctcatcatagaagcc
cctacagaatttgtggaacacttggaagaccagacagtcaccgagttcgacgatgctgtc
ttctcctgccagctctccagagagaaggcaaatgtaaaatggtacagaaatgggagagaa
atcaaagaaggcaaaaaatacaaatttgaaaaggatggcagcgtacacagactcattatt
aaggattgccggctggatgatgaatgtgaatatgcttgtggagtagaagacaggaagtct
cgagctagactctttgtggaagaaatccctgttgagatcatcaggcctccccaagacatc
cttgaagcccctggtgctgatgttgtctttttagctgagctcaacaaagataaggtggaa
gtccaatggctaaaaaataacatgattattgtccagggtgacaaacaccagatgatgagt
gaaggaaagatacacagactacagatctgtgatattaagccccgagaccagggtgaatac
agatttattgccaaagacaaagaagccagagctaagcttgaactggcagctgcacctaaa
atcaagacagctgatcaagacctcgtggttgatgttggccagcccctgacaatggtggtg
ccctatgaggcctaccccaaagcagaagcagagtggtttaaagaaaatgagcccctttct
tcaaaaaccgttgatactacagctgagcaaacttccttcagaatttcagaagccaagaaa
ggggacaaaggaaggtataaaattgtccttcagaacaaacatggaaaagcagaagcattc
atcaatttacaagttattgatgttcctgggccagtacgtaacttggaagtgacagaaaca
tttgatggtgaagtgagcctcgcttgggaagaaccattaactgatggtggaagcaaaatc
ataggttatgttgttgaaagacgtgatatcaagagaaagacctgggttctggccactgac
cgtgcagacagttgtgagtttactgtcactggactacaaaaaggaggagttgagtacctg
ttccgtgtgagtgcaagaaacagagtcggcactggtgaaccagtagaaactgacagtcct
gtcgaagcaaggagcaaatatgatgttccaggtcctcctttgaatgtagcgatcactgat
gtgaatagatttggtgtctcactgacatgggaaccaccagagtatgatggaggtgccgag
atcacaaactacgtcattgaattaagggacaaggcttctatcagatgggaaactgccatg
accgtaagagctgaagacctgtctgcaaccgtcactgatgtggtggaaggacaggagtac
agtttccgggtcagggcccaaaaccgaatcggagttggaaaaccaagtacagccacaccc
tttgtcaaagttgctgatccaattgagagaccaagtcctcctgtgaacctaaattcttca
gatcagactcagtcatcagttcagctcacatgggaacctcctctgaaagatggaggaggc
ccaatattgggctatatcatcgaacgatgtgaagaaggaaaagataattggattcgttgc
aataagaaacttgtccctgaactgacttacaaggttactggattacaaaaaggaaataaa
tatttgtatcgagtatctgcagaaaatgaagctggtgtttcagatccatctgaaattctt
ggtcctctgactgctgatgatgcatctgttgaaccaacaatggatttaagtgcatttaaa
gatggcctggaagttattgtcccaaatcctatcaagatcctggttccaagtacgggctat
ccaaggccaactgctacctggtcttttggagataaagtactagaagcaggggaccgtgtg
aaaatgaaaaccctgtctgcctatgctgaacttgtcatttctccaagtgaacgtccagac
aagggcatttatacactgaaattagaaaatccagtgaaagcaatttctggggaaattgac
gtcaatgtaattgctcgcccaagtgcacccaaagaactgaaatttggtgagataaccaag
gactcagtacatttaacttgggaaccaccagatgatgatggaggaagtccactgactggt
tatcttattgaaaagcgagaagtcagccggaaaacatggactaaagttatggactttgtg
actgaactagaattcacagttcctgatcttgttcaaggaaaagagtatttatttaaagtc
tgtgctcgtaacaagtgtggccctggagaacccgcatatgttgatgaacctgtaaatatg
tcagctcctgcaacggttccagatccaccggagaatgttaagtggagagatcgaacagcc
aacagcatcttcctaacatgggatccacctaaatatgacggtgggtcacgcatcaaagga
tatttagttgaaaaatgtccacgtggttctgatcgatgggtcgcctgtggagaaccagtt
gcagaaacaaaaatggaggtgacaggtcttgaagaaggcaagtggtatgcctaccgcgtg
aaggccttgaacaggctaggtgctagcaaaccaagcaaacccacagatgaaatccaggct
gtggacacccaggaggctccagaaattttcctcgatgtgaagctgcttgcgggtctcact
gtaaaagcaggaaccaagattgaacttcctgccactgtaactggcaagcctgaacctaaa
gtaacttggacgaaggcagatatgcttctgaagcaggacaagagaatcaccattgaaaac
gttcctaaaaaatccacagtgacaattgtcgatagtaagagaagtgacactggcacgtac
atcatcgaggccgtgaacgtctgtggtcgggcgaccgctgtggtagaagtgaatgtctta
gataaacctggacccccagctgcttttgacatcacggaagtcaccaacgagtcatgtctt
ctaacatggaacccaccacgtgatgacggtggatctaaagtcacaaattatgtcgtggag
agaagagcgactgatagtgaagtgtggcacaagctttcgtcaactgtcaaggatacaaag
ttcaaggcaaccaaattaacacccaataaagaatatatcttcagagttgctgcagaaaac
atgtatggtgttggtgagccagttcaggccactccaataacagccaaatttcagtttgat
ccacctggacctccaactcgcctggaaccttctgatatcactaaagatgcagtgactctc
acttggtgtgagccagacgatgatggtggcagcccaatcacgggatactgggttgaaaga
ttagatcctgatactgataaatgggttagatgcaataagatgccaataaaggacacaaca
ttcagagtgaaaggcctcaccaataagaaaaaatacagattccgcgtgttggctgaaaat
cttgcaggacctggaaaaccaagcagatcaactgagccagtcttaataaaggatcccata
gatcctccatggccccctggaaaaccaactgtgaaagatataggcagaacatcattaatg
ttgaactggacaaagccagaacatgatggaggggcaaagatcgagtcttacgtcattgaa
atgctaaagacgggaacagaggactgggtccgagtggctgaaggggttcccaccactcag
catttgctcccagggctcatggaagggcaggaatactcattccgagttagagctgtgaac
aaggccggggagagtgaacccagtgaacccagtgaccctgtgctttgccgggagaagctc
tatcccccatcaccacctcgctggcttgaagttattaacattaccaaaaacacggcagac
ctgaagtggacagttcctgagaaagatggagggtcccctatcaccaactacattgtggaa
aagagagatgtgagacgaaaaggctggcaaacagtggacacaactgtcaaggacaccaag
tgcacggtgaccccattgacagagggttctttatatgtgttccgagttgctgcagaaaac
gccataggacaaagtgactattgtgaagtcgaggactctgtcctggccaaagacaccttt
accactccgggaccaccctatgctctggcagtggttgatgtcacaaaacgacatgttgac
ctgaagtgggaaccacctaaaaatgatggtggaaaaccaatacagagatacgtcattgaa
aagaaagaaaagttaggtacccgttgggtgaaagctggaaagaccgcaggacccgactgt
aacttcagagtaactgatgttattgaaggaacagaggtccagtttcaggttcgggcagag
aatgaagctggagttggtcacccaagtgaacccacggaaatcctgaccattgaagatcca
acaagtcctccttcacctccccttgacctacacgtgacagatgcggggagaaagcacatt
gccattgcttggaaacctccagagaaaaatggtggaagtcctattataggataccatgtt
gaaatgtgtccagtaggcactgagaaatggatgagagttaattctcgcccaataaaagat
ttgaaatacaaggttgaagaaggtgttgttcctgacaaggagtacgttctgagagtgaga
gccgtcaatgctgttggtgtcagtgagccgtctgaaatctctgaaaacgtggttgccaaa
gacccagactgcaagccaacaattgatctggagactcacgacattgttgtcattgaaggt
gaaaagttaagcattcctgttcccttcagagctgtcccagttccaaccgttagttggcat
aaagatggcaaagatgttaaagcaagtgatagattaacaatgaagaatgatcacatctct
gcacacctcgaagttcccaagagtgtccatgcagatgctggagtctacaccattaccctg
gagaataagcttggctcagcaactgcctcaatcaatgtcaaagtcataggcctacctgga
ccatgcaaagatattaaagcaagtgacatcaccaagagttcttgtaaattaacctgggaa
cctccagaatatgatggtggaagcccaattcttcattatgtcctggaacgcagagaagcc
gggagaaggacatatataccagtcatgtctggtgagaacaaattatcttggactgtaaaa
gatctcataccaaatggtgaatacttcttccgtgtcaaagctgtcaacaagattggtgga
ggcgaatatattgaactgaaaaatccagtcattgctcaagatccaaagcagccccctgac
ccacctgtagatgttgaggttcataatcccacagctgaggcaatgactattacatggaag
ccacctttgtacgatggagggagcaagatcatgggttacatcatagagaagattgctaag
ggtgaagagagatggaagaggtgcaatgaacacctggtaccagtcctgacctatacagca
aagggacttgaagaaggaaaggaataccaattccgtgtgcgagcagaaaatgctgctggt
attggcgaaccttctagggccactcctccaaccaaagctgtagatcctattgatgccccg
aaagtcattatgagaacaagcctagaagtgaggcgaggtgatgaaatagcgcttgatgca
actatttctgggtcaccttacccaactattacatggctaaaggatgaaaaagtcatcata
ccagaggaaattaagaagcgagcagcacccctagttaggaggagaaggggtgaagttcaa
gaagaagagccatttttcctgcctctgacagaacgtttgagtatcgacaatagtaaaaaa
ggagaatctcagctacgtgtccgagattctctccgacctgaccacgggctgtttatgatc
aaagttgaaaatgaccacggtattgcaaaagctccctgtactgtcagtgtgctagatata
ccaggaccaccaatcaacttcatattcgaagatgttagaaagaactcagtcctctgtaaa
tgggaaccacccctagatgatggtggcagtgaaattataaactacactttggaaaagaaa
gacaagacaaaacctgactcagaatggattattgtcactgctacccttagacattgcaaa
tacccagtgacgaagttgattgaaggaaaggagtacctcttccgtgtaagagctgaaaat
aggtttgggcctggaccaccatgtgtttcaaagccacttacagctaaagatccatttgaa
cctcctgacgcacctgataagcccattgtggaagatgttaccagcaacagtatgctagtg
acatggaatgaaccaaaagataatggaagccccatcctgggttactggctggaaaaacgt
gaggttaacagtacacactggtctcgtgtcaacagaaaccttctgaatgctttgaagacc
aaagtagaaggcctattagaaggtctcacctatgtcttcagagtatgtgccgaaaatgca
gctggacctggaaagttcagtcccccttcagatcccaaaacagcacatgatccaatctct
ccacctgggccacctatcccgagagtcactgacacaagttctacagctattgaactagca
tgggaacccccagctttcaatggtggtggggaaatcattggttactttgtcgataagcag
ctggttggcacaaatgaatggtcacgctgcacagagaagatgatcaaggcccgtgagtac
actgtcaaagaagtccgagagggtgccgattataaacttcgagtgagcgctgtcaacgct
gcaggtgaaggaccgcctggagaaacagaacctgtgactgtggctgaaccacaagagcct
ccaactgtggaactagatgtttctgtcaaggctggaatacagataatggctgggaaaact
cttagaattccagctgtggtaactggtcgtcctgtgccaacaagagtgtggaccaaagaa
gaaggagacctggataaagaccgtgttgtaatagagaacgttggaaccaaatctgaacta
attatcaaggatgcattgagaaaagatcatggcagatatgtgattacagctaccaacagc
tgtggttccaaatttgcagcagccagggtagaagtttttgatgtccctggtccagttctt
gacttaaaacctgttgtaacaaacagaaagatgtgtctgcttaactggtctgatccagaa
gatgatggaggaagtgacatcacaggctttatcattgaaagaaaagatgctaagatgcat
acctggagacagccaatagagactgaaagatccaaatgtgatatcacgggtctccttgag
ggacaagaatatatgttccgtgtgattgccaagaacaagtttggctgtggccctcctgtt
gaaataggaccaattcttgcagttgatccactaggccctccaacgtctcccgagaggctc
acatatacggaaaggaccaagtccactatcacccttgactggaaagagccccgcagtaac
ggtggcagccccatccaaggctatattattgaaaaacggcgtcacgacaaacctgacttt
gaaagagttaacaagcgactctgcccaaccacgtcttttctggttgaagacctcgatgaa
caccaaatgtatgagttccgtgtcaaggctgtcaacgaaattggtgaaagtgaaccgtcc
ctgcctcttaatgtggtcatacaagatgatgaagtgcctccaactattaagttgcgcctg
tctgttcgaggagacactatcaaagttaaggcaggagagcctgttaacatccctgcagat
gtgacaggccttccaatgcctaagattgagtggtccaagaatgagaaagtgattgaaaaa
cccagtgatgcacttaagataaccaaggaagaagtatcccgaagtgaggcaaagactgag
cttagcattcccaaagcagtccgggaggacaaaggcacttacacagtcactgcttctaac
cgccttggctcagtgttccgaaatgttcatgttgaagtatacgaccgtccatccccacca
aggaatcttgctgttactgacattaaagctgaatcttgctacttaacatgggatgcccct
ctagacaatggtggcagtgaaatcacccattatgtcattgacaaacgcgatgcaagtagg
aagaaagctgaatgggaagaagtcaccaacactgctgtagagaggagatacgggatctgg
aaacttatccctaatggtcagtatgagttccgagttagagcagtgaataaatatggaacc
agtgatgaatgcaagtcagataaagtggtcattcaagatccttatcgtccacctggacct
ccaggaaaaccaaaagttttggagcgcaccaaagggtcgatgctagtgagctggactcct
cctttggacaatggtggctctccaattactggctactggctggagaagagagaagaggga
ggtgcctactggtcacgtgttagccgagcaccaataaccaaaatgggattgaaaggcgtg
gaatttaatgttccccgtttgattgaaggtgtgaaataccagttcagagcaatggcaatc
aacgctgcgggagtcggccctcccagtgaaccatcagatccagctgttgcaggagatccc
atatatccacctgggccaccttctcgtccagaggtcaaagataaaacaaagtcaagcatc
tcactggcatggaaacctccagccaaagatggtggcagcccaatcaaaggatacattgta
gaaatgcaggaagaaggtagtactgactggaagagtgtaaatgaaccggacaaactctta
actacctgtgagtgtgtggtgccaaatctgaaagagctcagaaagtacagattcagagta
aaagctgtcaacgaagctggtgaatctgaaccaagtgacacaactggagagatccctgcc
actgatgttcaggaggtaccagaagttttcattgacattggagcacaagactgtctaatt
tgtcaagctggcacacagattaggattcctgctgtcatcaagggacgcccaacaccaaaa
tcctcttgggaatttgatggaaaggcaaagaaggcagtgaaggatggggttcatgatatc
cctgaagatgcacagctggagactgctgaaaattcatcagtaattattattccagagtgt
aagcgatctcattcaggcaaatacagcatcacagccaagaataaagcaggacaaaagact
gcaaattgcagagttaaagtcatggatgtaccagggccacccaaagatctgaaagtcagc
gacatcacaaggggtagttgcaaacttacatggaagatgccagatgatgatggaggagac
aggatcaaagggtatgttatcgagaagaggactattgatggaaaagcctggactaaagtc
aacccaagctgtggaagcacctcatttgtagttcctgacctcatctctggacaggaatat
ttcttccgtgtacgggcagaaaaccgttttggaattggtccacctgtggaaaccattcag
aggaccactgccagagacccaatatatcctcctgatcctcctattaaactcaagattggc
ctcataacaaagaacacagtacacctgtcatggaaacccccaaagaatgatgggggctcc
cctgtcacccactatattgttgagtgccttgcatgggatcctactgggacaaagaaagaa
gcatggaaacagtgcaacaaacgtgacgtggaggaactggagtttaccgccgaagacctc
atagagggtggggaatacgaattcagggtcaaagccgtcaatgctgcaggagtcagcaaa
ccttcagacactgttggccctgtgattgtcaaagaccagacatgcccaccttcaattgag
ctaaaagaattcatggaggttgaagaaggaactgatgttaacattgtggccaaaattaaa
ggtgtgccattcccgacactaacctggtttaaagctcctccgatgaagcctgataagaaa
gaacctgttgtctatgacacccatgtcaacaaactggtggtggatgatacttgcacctta
gttattccacagtctcgcaggagtgacactggcctatataccatcacagccgtgaataat
ctgggaacagcatcaaaggaaatgagactgaatgtccttggtcgccctggccctccagta
ggaccgataaagtttgaatctgtttcagcagatcaaatgacattatcttggcttccacct
aaagatgacggtgggtctaagattaccaactatgtaattgagaaaagagaagctaacagg
aagacatgggtacgtgtctccagtgaaccgaaagagtgcatgtacacaattcccaaactg
ctggaaggccatgagtacgtattccgaatcatggcccagaataaatatggcattggtgag
cctcttgacagtgagcctgaaacagcaagaaacctcttctctgtccctggagcacctgat
aaaccaacagttagcagtgtgactcgtaattccatgactgtcaactgggaagagccagaa
tatgatggaggctctcctgtgacaggatactggctagaaatgaaagataccacttcgaag
agatggaagagagttaaccgagatcctatcaaagccatgactttgggtgtttcttataaa
gtgactggtctcattgaaggttctgattatcagttccgggtgtacgccatcaatgctgct
ggtgtgggtccagcaagtctgccctcagacccaacgactgctagagatccaattgcccct
cctggcccaccatttcccaaagtcacagactggaccaaatcatctgcggatctggagtgg
tctcccccactaaaagatggtggatccaaagtaaccggatacatcgttgaatataaagaa
gaaggcaaagaagagtgggaaaaggctaaagataaagaagtgagaggaacaaaacttgtt
gtgacaggattaaaagaaggagcattctacaaatttagagttagagcagtcaacattgct
ggcattggagaacctggagaagtcacagatgccattgaaatgaaggacagaattgtatta
cctgacattcagctggatgccagcgtcagagacagaattgtggtccatgctggaggggtg
attcggatcattgcctatgtgtctggaaagcctcctccaaccattacttggaacatgaat
gaaagagcattacctcaagaagccaccattgagtccacagccattagctcatccatggtc
atcaagaattgccagaggagccaccaaggcgtctattctcttcttgccaaaaatgcagcc
ggggaaagaaagaagacaattatcgttgatgtattagatgtgccaggccctgttggaata
ccattcctgcctcacaacctaaccaatgactcctgcaaattgacatggttctctccagaa
gatgatggaggctctccaatcaccaattatgtaattgaaaagagggaatctgaccgcaga
gcatggaccccagtgacatgcacagtcacccgacaaaatgctactgtccaaggtctcatt
caaggaaaagcctactttttccgaattgcagctgaaaatagtattggcatgggcccgttt
gttgagacaacagatgcacttgtcataagagatccaataactgtaccagagcgtcctgaa
gacctagaagtcaaagaagttactaaagattctgtcactttgacttggaatcctccaaag
tatgatggcggatcagaaattattaactacatcctagaaagccgtctcattggaaccgag
aagttccacaaagttacaaacgacaacttgcttggcaggaagtatactgtgaaaggctta
aaagaaggtgatacctacgagtaccgtgtcagtgcagtcaatattgttggacaaggcaaa
ccatcattttgcaccaagccaatcacttgcaaggatgagctggctcctccgacgcttgac
ctcgacttcagagataagctcacgattcgagttggtgaagcttttgccctcactggccgt
tactcaggcaaaccaaagcccaaggttacttggttcaaagatgacgctgatgtgctggaa
gatgatcgcactcacataaagaccactcctatgacacttgctctagagaagcttaaggcc
aagcgttcagattctggcaaatactgtgtggttgtggagaacagtacaggctccaggaaa
gggttctgtcaagttaatgttgttgaccgtcctggaccaccagtaggaccagttattttt
gatgaggtgaccaaagattacatggttatctcttggaagccacctttagatgatggaggc
agtgaaattaccaattacattattgagaagaaggagacaggcaaagatgtctggatgccc
gtgacatctgcaagtgctaaaacaacatgcaaagttcctaaactgcttgaagggaaagat
tatattttccggatatatgctgaaaatctgtatggaataagtgatcctctggtgtctgat
tcaatgaaagccaaagatcgcttcagagttcctgatgcacctgaccagccaattgttaca
gaagttaccaaagactctgcattagtaacctggaacaagccaaatgatggtggaaagccc
atcacaaactacatcctggagaagagggaaactatgtctaaacgatgggctagagttacc
aaagagcctatccatccacacaccaaatttagggttcctgatcttctagaaggatgtcac
tatgaattccgggtttctgcagaaaatgaaattggtattggagacccaagcccaccatcc
aaaccagtcattgctaaagatccaattgctaagccaagtccacctgttaatcctgaagca
atagatacaacatgtaattcagttgatctaacttggcagccaccccgtcatgatggtggg
agcaagattctgggttatattgttgagtaccagaaagttggagatgaagaatggaaaaga
gccaatcacactcctgagtcatgtcctgaaactaaatataaagtcactggtcttcgggat
ggtcagtcctataagttcagagtaatagcagttaatgaagctggtgaatcagatccagct
catgtaccagagccagtgctagtaaaagacagactcgaaccacctgagttgattcttgat
gccaacatggcaagagaacaacacataaaagttggtgacactctgagacttagtgccatc
atcaaaggagtgccattcccaaaagtaacctggaaaaaaggagacagagaggctccaact
aaagcacgaattgacactactccagttggtagcaagcttgaaattcgtaatgctctccat
gaagatggtggaatgtattccttaacagtagagaatccagctggttcaaaaactgtctca
gtaaaagtactcgtattagataagcctgggccacctagagatctggaagtcagtgaaatt
aggaaagattcttgttaccttacttggaaggaaccactagatgatggtggttctgtcatt
acaaattatgtggttgagaggaaagatgttgccagtgcccagtggtctcctctttcaact
acatcaaagaaaaagagtcacatggctaaacatcttaatgaaggtaatcagtacctcttc
cgagtagctgctgagaaccagtatggacgtggtcctttcgtggaaacacttaaacccatc
aaggctctggatcccctacatcccccagggccacccaagaacctacaccatgtagatgtt
gacaagactgaagtgtcccttgtttggaataagccagatcgtgatggtggctctccaatc
actggatatttggtggaatatcaagaagagggcactgaagactggattaagttcaagact
gtgacaaacttagagtgtgttgtcactggactacaacaaggaaagacttacagattccgt
gtaagagctgaaaatattgtgggtcttggtcttcccgacacaactatcccaatagaatgt
caagaaaaactagtgcctccatcagtggagctggatgtgaaattaattgaaggccttgtg
gtaaaagctggaactacagtcagattccctgccattataagaggtgtacccattcctact
gcaaagtggacaaccgatgggaatgagattaaaacagatgaacactatacagttgaaact
gacaacttctcatcagttcttaccattaagaactgcttaaggaaagacactggggaatat
cagatcacagtttccaatgctgctggcaccaaaaccgtagccgtacatcttactgttctt
gatgtccctggtccaccaacaggccccattaatattctggaagttacccctgaacacatg
actatctcatggcagccgcctaaagatgatggaggaagccctgtgataaattatattgtt
gagaaaaaagacaccaagaaagacacgtggggtgttgtctcttcaggaagcagtaagaca
aagctgaaagtcccacatctgcaaaagggctgtgaatatgttttccgagttaaagcagag
aataagattggtgttggtcctcccctggactccatacctactgttgctaaacataagttt
agtcctccatctcctcccggtaaaccagtggttactgacattactgaaaatgcggcaaca
gtgtcttggactctgccaaaatctgatggtggcagtccaataaccggttactacatggaa
cgtcgagaagtaacgggcaaatgggtgagagtcaacaaaacaccgatagccgacctgaag
tttagagtgactggactctatgagggaaatacatacgagtttagagtttttgctgagaat
cttgcaggactaagcggtccatccccaagttctgatccaataaaagcctgccggcccatc
aaaccacctggaccacctattaatcctaagctgaaagacaagaccagagaaacagctgac
ctagtatggacaaagcctctcagtgatggtggtagccccattctgggctacgtagtggag
tgtcagaaagctggaacaacacagtggagcaggattaataaagatgaactgatcaggcag
tgtgccttcagggtacctggacttattgaaggaaatgagtacagattccgtataaaggca
gctaatattgtgggagagggagagccaagagaactagcagagtctgtgattgcaaaggat
atccttcaccctccagaagtagaacttgatgtgacttgtcgtgatgttattaccgttaga
gtaggccaaactatccgcattcttgctcgggtaaaaggcagacctgaaccagacataacc
tggtctaaggagggcaaagcattggtccgagaaaagcgagttgacctaattcacgatctg
cctcgtgttgagttacatattaaggaagctgttagagctgaccatggcaagtatatcatc
tcagctaagaacagcagtgggcatgcccaaggtcatgctatcgttaatgtcctcgacaga
cctgggccttgccagaatttaaaggtcagcaatgtaaccaaagagaactgtacaatttct
tgggaaaacccactagataatggtggctcagaaataacaaatttcatagtggagtatcgc
aagccaaaccagaaaggctggtcaattgttgcttcagatgtcactaagcgattaatcaag
gccaaccttttagccaacaatgaatactacttccgagtttgtgcagagaataaagtaggt
gttgggccaaccattgaaacaaaaactccaattctggctattaaccctattgatagacca
ggtgagcctgaaaaccttcatattgcagataaaggaaagacatttgtctatctgaagtgg
aggcggcctgactatgacggtggtagcccaaatctgtcatatcacgttgaaaggaggctg
aagggctctgctgactgggaaagagtgcataaaggaagcattaaagatacccactacatg
gttgacaaatgtgttgaaaaccagatttatgagttcagagtgcaaacgaagaatgaaggt
ggagaaagtgactgggtaaagacagaggaagttgttgtgaaggaagacttgcagaaaccg
gtgcttgatctgaaattaagtggcgtgctaactgtcaaagcaggcgacaccattcgactt
gaggcaggtgttagaggcaaaccgtttcctgaagttttatggaccaaggacagagatgct
acagacttaacaagatcaccaagggtcaaaattgagaccggtgctgactcatctaaattt
tctctcactaaagcaaagcgaagtgatggtggtaaatatgtaattacagcaacaaacaca
gctggcagttttgtggcctatgccactgtcaatgttttagataagcctggtcctgtgaga
aacctgaaaatcgttgatgtgtccagcgacaggtgtagtcttcactgggatccaccagag
gatgacggtggctgtgaaatccaaaattatattgtagaaaaatgtgagagcaagcgaatg
gtttggtctaccttttcctctactatcttaacacctggtgctacagtaactcgtctcata
gaaggaaatgaatatatcttcagagtccgtgcagaaaataaaataggcacagggcctcca
acagaaactaaaccagtcattgcaaaaaccaagtatgacagacctggacgccctgatccc
cctgaagtcactaaagtaagcaaagaagagatgactgtggtttggactccacctgaatat
gatggtggaaagtctatcacaggatactttttggagaaaaaggaaaaacattcaacacga
tgggtccctgtcaacaagagtgcgatccctgagagacgtttgaaagtacagaatctcctc
ccaggacatgaatatcagttccgtgtcaaggcagaaaatgaaattggaattggagaacca
agcttgccctcaagaccagtggtggcaaaagaccccatagaaccacctggtccaccaacc
aacctcaaagtggttgatacaaccaaaagttccataactcttgggtggggaaaaccagtg
tatgatggtggtgcaccgataattggatatgttgtggaaatgagaccgaaaatagcagat
gcatcacctgatgaaggctggaaaaggtgcaatgctgcagcacaacttgttcgcatggaa
ttcactgtcaccagcttagatgaaaaccaggaatatgagttcagggtgtgtgcccaaaac
caggttggcattgggcgccctgcagaactaaaggatgctattaaacctaaagagatccta
gaacctccggagattgatctggatgccagcatgagaaaactggtcacggtgagggcagga
tgccccattcgactatttgccatagtgagagggcgaccagcccctaaggtcacttggcga
aaagtgggtattgataacgtggtcagaaagggacaagttgatctggttgacactatggcc
ttcctcgtcatccccaattctacgcgagatgactcgggaaaatactccctgacgcttgtg
aacccagcaggggaaaaggctgtgttcgtgaatgtcagagtattagatactcccggacct
gtgtctgatttaaaagtttcagatgtcactaaaacatcatgccacgtttcctgggcccct
cctgagaacgacggtgggagccaagtaacgcattatattgtggagaaacgtgaggcagac
agaaagacgtgggcgacagtcaccccagaagttaagaaaacgagcttccacgtcaccaat
cttgtccctgggaatgagtatttcttccgagtcactgctgtcaatgagtatggccctggt
gtcccagccgacgtccccaaaccagtgctcgcctcagatcctctaagtgagccggatccc
ccaaggaaactagaagttactgaaatgaccaagaacagtgctgcattagcctggttacct
cccctgcgtgacggaggtgctaaaatcgacggctacatcattagttacagagaagaagag
cagcctgcagaccgctggacagagtactcggtggtgaaagatctcagccttgttgtcact
gggctaaaggaaggaaagaaatacaaatttagagtagtggccagaaatgctgtcggcctc
agtctgccaagagaagctgaaggagtctatgaagccaaagaacagctgttgccaccaaag
atcctcatgccagagcaaattactattaaagccgggaagaaactccgaattgaagcccat
gtgtatggaaagccttatccgatctgtaaatggaagaaaggagaggatgaagttgtcaca
tccagccacctggcagtgcataaagcagacaattcttcagttctgatcataaaagatgtt
actcggaaagacagtggttactacagcctcactgcagagaacagttctgggacagacact
cagaagatcaaagttatcgtcatggatgctcccgggcccccccagcctccattcgacatt
tctgacatagatgctgacgcttgctccctgtcatggcacatccctcttgaggatggaggc
agtaacatcaccaactacatagtggagaaatgtgacgtaagccgaggggactgggtgact
gcactagcttcagtgacaaaaacgtcctgcagagttggaaaactgatccccggccaagag
tacgtcttccgggtccgtgctgagaatcgatttggcatttcagagcctctcacatctcca
aagatgctggctaagttcccatttgatgttcccagtgagccaaagaatgctcgagtcacc
aaagtcaacaaagactgcatatttgtggcatgggacaggccagacagtgatggagggagc
cctattaccggttacctgattgaacgcaaagagaagaacagtttgctctgggtgaaagct
aacgacactcctgtccggtcaactgaatacccctgtgctggcttggtagaaggccttgag
tattcattcagaatctatgccctaaacaaagctggatccagcccacccagcaaacccact
gaatatgtaactgcaagaatgccagttgatcctcctggaaagcctgaagttattgatgtt
accaagagtactgtatccctcatctgggctcgtccaaagcatgatggaggcagtaaaatt
attggctatttcgtagaagcttgcaaacttcctggtgataagtgggtacggtgcaatact
tcccctcaccagattccccaggaagagtatacagctactggcttagaagagaacgctcag
tatcaatttagagcaattgccaagactgcagtaaacatcagccagccttctgaaccttcg
gatccagtgaccatcgttgcagaaagtgttcctcccaggatagacctgagtgtggctatg
aaatctttgcttactgtgaaagctggcactaatgtttgcctggatgccactgtttttggt
aaaccaatgcccacagtctcttggaagaaggatggcacgccgctgaaaccatcagaaggc
atcaagatggccatgaagcggaatctgtgcaccctggagctgttcagcgtgaaccgaaaa
gactcaggggactataccatcactgccgaaaacgcaagtggctccaaatcggccaccatt
aagcttaaagtgttagataaaccaggtcctccagcatccgtaaaaatcaacaaaatgtat
tcagatcgtgcaatgctttcttgggaacctcctcttgaagatggaggctcagaaatcacc
aactatattgttgacaaacgtgaaacaagcagacccaactgggcacaagtgtctgctact
gtacccatcaccagctgcagcgtggagaagctgatagagggccatgagtatcagttccgg
atttgtgctgaaaataagtacggagtgggcgatccgatcataactgaaccagcaattgct
aaaaacccatacgacccacctggacgctgtgatcctcctgttattagcaacataaccaaa
gatcacatgacagtaagctggaaaccaccagcagatgatggcggctcacccatcactggc
tatttgcttgagaagcgggaaacccaggcagttaactggaccaaggtcaacagaaaacct
gttatagaaagaacgataaaagcaacaggtctccaagaaggcactgaatacgagttccga
gttatagctataaataaggctggaccaggcaaacccagtgatgcatccaaagctgcgtat
gcccaagaccctctgtatcctccgggcccaccagcttttcccaaagtatatgatacaacc
cgcagctccgtgagtctatcttggggcaagccagcctatgacggtggtagtcctatcatt
ggctaccttgttgaagtaaaacgagctgactctgataactgggtgaggtgcaatttacca
cagaagttacagaaaacccgctttgaggtcactggcctaatggaaaacacagagtatcag
ttccgcgtgtatgccgttaataagattggctacagtgaccccagtgatgtgcccgataaa
cactgtcccaaggacatcttaattccaccagagggagaacttgacgctgatttgaggaaa
acactcatattacgtgctggagttacaatgagactgtacgtaccagtaaaaggacgtcca
cctcccaagataacttggtctaaaccaaacgtcaatctaagagaaaggattggactggac
atcaagtcaactgactttgacactttcttgcgctgtgaaaacgtgaacaagtatgacgca
ggaaaatacatcttgactctggagaacagctgtggtaaaaaggaatataccattgtagtg
aaagtgcttgatactcctgggccacctgtcaacgtgactgtcaaggaaatatccaaagat
tctgcttatgttacctgggatccgcccattatcgatggcggaagccccatcataaactac
gtggtagaaaaacgtgacgcagagaggaagtcctggtctaccgtgacaacggagtgctca
aaaacaagcttcagagtctcgaacttggaggagggaaaatcctacttcttcagggtgttt
gctgaaaacgagtacggcattggtgatcctggtgaaacgcgtgatgccgtcaaagcttcc
gaaacccctggaccagttgtggatctgaaagtgacttctctcacgaagtcatcttgtagc
atagcctggaaaaagcctcgcagtgatggtggaagtcgaattaccggatacgtagtcgat
ttcctgactgaagaaaataagtggcaacgagttatgaaatcattaagcttacagtactcc
acaaaagatttgactgaagggaaggaatatgccttcagagtgagtgctgagaatgaaaat
ggagaagggaccccaagtgaaatcagcgttgtggcaaaggatgatgttgtggctcctgac
cttgacttgaaggatctacctgatttgtgctatgtggcaaaagaaaacagcaacttccgt
ctaaagatccccataaaaggcaagccagcaccatctgtgtcctggaagaaaggggaagac
cctctagcaactgacacgagagtcagtgttgagtcatctgcagttaacacaactcttgta
gtatatgattgccgaaaatctgatgctggaaaatacacaatcacactgaagaatgttgct
ggcaccaaggaaggaactctctccataaaagttgttggcaagcctggcatccccactgga
ccaatcaaatttgaggaagtcacagcggaagccgtcaccttgaagtggggtcctccaaag
gacgacggaggttctgaaatcaccaactatatcctagagaagagagattctgtaaacaac
aagtgggtgacatgtgcctcagctgtccagaagaccaccttcagagtaatgagacttcac
gagggtatggaatacaccttcagggtcagtgcggaaaataaatacggtgtaggagagggc
ctgaaatcggagccaattgttgctaaacatccatttgatgtgcccgatgctcccccacct
cccaatattgtggacgtcagacatgattccgtatctctaacttggactgaccccaggaaa
actggtggctctccaattacagggtatcatatcgaattcaaggaaagaaacagccttttg
tggaaaagagctaacaagactcctattaggatgaaagacttcaaagtgacaggtctaact
gaaggtctagaatatgaattccgagtcatggcaatcaatttagcaggagtaggcaagcca
agcctaccatcagagccagttgtggcacttgatccaattgatcctcctggcaaacctgag
gttattaacgtaacaaggaattcagtgactctcatttggactgaacccaaatatgatggt
ggtcataagttgactggatatatagtggagaagcgagatcttccctctaagacttggatg
aaagccaaccatgttaatgtcccagactgtgcctttactgtaactgaccttgtcgagggt
ggaaaatatgaattcagaattagagcaaagaatacagcaggggctatcagtgctccatca
gaaagtacaggaaccatcatttgcaaggatgaatacgaggcaccaaccattgtccttgat
cccacaataaaagatgggctaacagttaaagctggagacactattgtcttgagtgccatc
agcattcttggcaagccccttccaaagtcaacttggtccaaggcaggaaaagacataaga
ccatcagatattgttcagatatcttcaactccaacatcttccatgctcgctatcaagtat
gccactagaaaagatgctggtgaatataccatcactgctaccaatccttttggcacaaag
ggggaacatgtgaaggtgaccgtcctcgatgtacctggtcccccaggtcccatcgaaatc
agtaatgtttctgctgagaaagcaacacttacatggacacctcccttggaagatggtggc
tcacccattaagtcctacgttcttgaaaagagagaaaccagccgacttttgtggacagtg
gttgctgaagatattcagtcttgcaggcatgtggcaaccaaacttatccaaggaaatgag
tacctcttccgagtctcagctgtaaaccagtatggcaaaggagaacctgtagagtctgaa
cctgtcaagatggtagacagatttggtccccctggccctcctggaaaaccagatgtgtca
aatgtcactaaaaatactgccactatcaattggaaaagaccagttgatgatggtggcagt
gagatcacaggataccatgtagaaaggagagagaagaaaggcttgcgatggatgagagca
acaaagacgccagtttctgatctcagatgcaaagtaacaggactgcaagaaggaaacacc
tacgaattccgtgtcagtgcagagaacaaagcaggaattggtccacctagtgaggcttca
aatcctgtcctaatgaaagatgtggcataccccccaggaccaccttcaaatgcacgtgtc
accgatactaccaagaaatctgcttcgttggcttggggcaagcctcactatgacggtgga
cttgaaatcactggctatgtcgtagagcatcaaaaagtaggggatgatgcctggataaag
gacacaacaggaactgccctcagaatcactgaatttgttgtccccgatcttcagactaaa
gaaaaatacaattttagaatcagtgccatcaacgatgcaggtgttggggagccagcagtg
attccagatgttgaaattgtagaacgggaaatggctcctgattttgaactagatgctgag
cttcgaagaacacttgtcgtgagagcaggactcagtattagaatattcgtgccaatcaaa
ggtcgtcctgctccagaagtgacatggaccaaagatgatatcaaccttaaaaaccgagct
aacatcgaaaatacagaatcatttactctcttgattatcccagaatgtaacaggtatgac
accggtaaatttgtgatgaccatcgaaaaccctgccgggaagaaaagtggcttcgttaac
gtccgagtcttggatacaccaggacccgtccttaacctgaggcctactgacatcacaaag
gagagtgtcaccctgcactgggacctccctctgatagacgggggctcacgtataacaaac
tatattgtggagaaacgagaagcaacacggaaatcttactccacggtcaccaccaagtgc
cacaagtgcacatataaagttactggcttgtctgaaggatgtgaatactttttcagagtc
atggcagaaaacgaatatggaatcggtgagccagcagaaaccacagagcctgtaaaagcc
tccgaagcaccatcaccgccagacagtcttaacattatggacataaccaagagcacagtc
agcctggcatggcctaaaccaaaacacgatggtggcagtaggatcactggctacgtgatt
gaagcccaaagaaaaggctctgaccagtggacccacatcacaacagtgaagggactggaa
tgtgtggtgaagaatctcactgaaggggaggaatacaccttccaagtgatggcggtgaac
agtgcagggagaagtgcccccagagagagcaggcctgtcatcgtcaaggagcagacgatg
cttccagcattggatctccgcggcatttatcagaaattagtcattgctaaagctggtgac
aacatcaaagttgaaattccagtgcttggtcaaccaaagcccacagttacatggaaaaaa
ggagaccagattcttaaacagacccagagagttaattttgaaaatacagcaacttcaacc
atcttaaatatcaacgagtgtgtaagaagtgatagtgggccctacccattaacagcaagg
aacattgtgggagaggtgggtgacgtcatcaccattcaagtccatgatatcccagggcca
cctactggaccaatcaaatttgatgaagtttcatctgattttgtcaccttctcttgggac
ccacctgagaacgatggcggtgtaccaataagcaactacgtagtagaaatgcgacagact
gacagcaccacgtgggctgagctggcaactactgtcatacgcaccacctataaagccact
cgccttactaccggaatggaatatcagtttcgggtaaaagctcagaacagatacggagtt
gggccaggcatcacatcagcatcagtagttgccaactatccgtttaaggttcctgggcct
cctggtacccctcaggtaactgcagtctccaaggaggcaataacaattagctggcacgag
cctctttccgatggtggaagccccattttaggatatcacattgaaagaaaagaacgaaat
ggcatcctctggcagacagtgagcaaagcgttggtaccaggcaacatcttcaaatcaagt
ggacttacggatggtattgcttatgaattccgagtgattgcagaaaacatggcaggcaag
agcaagccgagcaagccgtcagagcctgcgttagctctggatcccattgacccacctggg
aaaccagttcctctcaatattacaagacacacagtgacactcaaatgggccaagcctgaa
tatactggaggctttaaaattaccagctatatagttgaaaagagagaccttcctaatgga
cggtggctgaaggccaacttcagcaacattttggagaatgaatttacagtcagcggccta
acagaagatgctagatatgaattccgtgtgattgccaaaaatgctgctggggctatcagc
ccaccgtctgagccatcagatgctatcacatgcagggatgaccttgaagcaccacggata
atggtggatgtcaaatttaaggacacgattacagtaaaagcaggtgaagccttcaaactg
gaagctgatgtttcaggccgcccacctccaacaatggaatggaccaaagacggaaaggag
cttgaaaatacagcaaaattagaaattaaaacagccgatttctctactaatctggtaaac
aaggactcattaagaagggatggtggtgcctataccctgacagcaactaatcctggtggt
tttgctaaacacatcttcaacgtcaaagttcttgacagaccaggcccacctgaaggacct
ttagctgtatctgaagtgacatcagaaaaatgtgtattgtcatggttgccaccactggat
gacgggggtgccaaaattgatcattatgtagttcagaaacgtgaaaccagcaggctggcc
tggaccaatgtagcctcagaagtccaagtgacaaaactaaaggtcactaaacttttgaaa
ggcaatgaatacatattccgtgtcatggctgtaaataaatatggagttggagagccactg
gaatcagagcctgtgcttgcagtagatccttatggacctcctgatccacccaaaaatcct
gaagttacagctattaccaaagaatccatggttgtctgctggggacatcctgactctgac
ggcggaagtgaaatcatcaattacatcgtggagcggcgtgacaaggctggccaacgctgg
gtgaaatgcaacaagaaaacccttaccgatttaagatataaagtgtctggactgacagaa
ggacatgaatatgagttcaggattatggctgagaacgctgctggagttagcgcaccgagt
gctaccagtccgttctataaagcttgtgatgctgtgtttaaacctggtcccccagggaat
ccccgtgttctagacacaagcagatcctccatttcaattgcttggaacaaacccatctat
gatggtggttccgaaatcactgggtatatggttgagatcgccctgccagaagaagacgaa
tggaagattgtcactccaccagccgggctcaaggcaacttcttacaccatcactaacctc
gtcgagaatcaagaatataaaatccgcatctatgccatgaattctgaaggcatcggggaa
cctgcccttgtgcctggaactcccaaggctgaggacaggatgctgcctccagagattgaa
ctggatgccgacctgcgcaaagttgtgactatcagagcttgttgtaccctgagacttttt
gttccaatcaaaggcaggcctgcaccggaggtgaagtggacccgggaacacggagaatct
ttggataaagctagcattgaatccacaagctcttacaccctacttattgtcggaaacgta
aacagattcgacagtggcaaatacatactaactgtagaaaacagctcaggcagcaagtct
gcatttgttaacgtgagagtactggacacgccaggccctccgcaggatctgaaggtaaag
gaggtcactaagacatctgtcaccctgacgtgggagcctcctcttctcgacggaggttca
aaaataaagaactatattgttgaaaagcgggaatcaacaaggaaagcgtattcaactgtt
gcaacaaactgtcacaagacttcctggaagatagatcagcttcaggaaggctgtagctac
tacttcagggtactcgctgaaaatgaatatggcatcgggctgccagccgaaaccgcagaa
tctgtgaaagtatcagaacgccctcttcctccaggaaaaataactctggtggacgtcaca
agaaacagcgtgtcactctcttgggagaaacctgagcatgacggaggcagccgaattcta
ggctacatcgtagagatgcagagcaaaggcagtgacaaatgggtcacgtgtgccacagtc
aaagtcaccgaagccactattactggattaattcagggtgaagagtactctttccgggtt
tcggctcagaatgagaagggcatcagtgacccgagacaactgagtgtgacagtaatcgcc
aaggacctcgttattccaccagccttcaaactcctgttcaatactttcactgttctggca
ggtgaagacctcaaagttgacgttcccttcatcggacgccctacaccagctgtgacctgg
cataaagatgatgtaccactgaagcagacaacgagagtgaacgcagagagcacagaaaat
aactcactgctgacgataaaggaagcctgccgagaagatgttggacattacgtagttaaa
ctgactaactcagctggtgaagctactgaaacccttaatgttatcgttcttgacaaacca
gggcctccaacaggacctgttaaaatagatgaagtgacagctgatagtattactctctcc
tgggacccaccaaagtatgacggcggaagctctatcaataattacattgtagagaaacgg
gacacgtcctcaaccacctggcagattgtgtcggctactgttgcaaggacaacaataaaa
gcttgcagattaaagactggatgtgagtatcagtttaggattgctgctgaaaacagatat
ggaaagagcacctacctcaattcagagtctgttgtagcccagtatcccttcaaggttcct
ggtcctcctggcacaccgttcgtaacgctctcctccaaggacagcatggaagtgcagtgg
aacgagccagtcagtgacggaggcagcaaagtcattggctatcacctagaacgcaaggaa
agaaacagcatcctctgggttaagctgaataaaacacctattcctcaaaccaagtttaaa
acaactggcctcgacgaaggcattgagtatgaatttagagtctccgcagagaacattgtg
ggtatcggcaagccaagtaaagtgtcagaatgctacgcagcccgtgatccatgtgatcca
ccaggcaggccagaggcgatcatcgtcacaaggaattccgtgactcttcagtggaagaaa
cccacttacgatggcggaagcaagatcaccggttacattgttgagaagaaagaattgccc
gagggccgctggatgaaagccagttttacgaacgttattgacactcaatttgaagtcact
ggcttagtggaagatcacagatacgagtttcgggttatagctcgaaatgctgcaggcgtg
ttcagtgagccttcagaaagcacaggagcaataacagcaagagacgagacagaaccacca
cgaatacgtatggatccaaaatacaaagacacagttgtggttcacgctggtgagttattc
aagattgatgcagatatttatggtaaaccaatacccaccactgagtggataaaaggtgac
caggagctttcaaatacagctcgactggaaataaagagcactgattttgccaccagtctc
agtgtaaaggatgcagtacgtgtcgacagtggaaactacatcctgaaggccaaaaacgtt
gcaggagagaaatcagtcactgtcagtgtcaaagttcttgacagaccagggccacctgaa
ggacctattgttatatcaggagttacagcagaaaaatgtacactagcctggaaacccccg
ctccaggatggtgggagtgatatcataaattatatcgtggaaaggagagaaaccagccgc
ctggtttggactgtggttgatgccaacgtgcagactctcagcagcaaggttaccaagctt
cttgaaggcaatgaatatgttttccgtgtaatggccgtaaacaaacacggcgtgggcgag
cctcttgaatctgagccagtaattgccaagaacccatttgtggtgccagacgcaccaaag
gctccagaaatcacagcagtgaccaaggactcaatgattgttgtgtgggaaaggccagcg
tccgacggcggcagtgaaattcttgggtatgttcttgaaaaacgggataaagagggcatc
cgatggacgagatgccacagacgtctgattggggaattgcgcttgagagtaactggactc
ttagaaaatcacaattacgagttcagagtctcagccgagaatgctgctggccttagtgaa
ccaagcccaccttctgctcaccaaaaggcctgtgatcctatttataaaccaggacctcca
aacaatcccagagtcactgatattaccagatcgtctgtcttcctttcctggggcaaacca
atatatgacggaggctgtgaaatccaaggatacattgtggaaaaatgtgacgtgagtgtt
ggtgaatggaccatgtgcactccaccaactggaatcagcaaaacaaatatagaagtagag
aagctgttggaaaagcatgaatacaacttccgtatttgtgctgttaacaaagctggagtt
ggagaacatgctgatgtccctggacccgttacagttgaagaaaaattggaagcaccagac
attgatcttgacctagaactaaggaaaattattaatataagggcaggtggctccttaagg
ttatttgttcctattaaaggccgtcctacaccggaagttaaatggggaaagatggatggg
gaaatccgagacgcagctataattgacatcactagcagcttcacctctcttgttcttgac
aacgtcaaccgatatgatactggaaaatatactctcacgttggaaaacagcagtggaaca
aagtctgcctttgttactgtgagagtcctggacacgccaagtccacctgttaatctgaaa
gtcacagaaatcacgaaagactcagtatcaattacatgggaacctcctctgctggatggg
ggatccaaaattaaaaattacattgttgagaaacgtgaagccacaagaaaatcatatgct
gcagttgtaacaaattgccataagaattcgtggaagattgatcaactccaggaaggatgc
agttactactttagagtcacagctgagaatgagtatggtattggccttcctgcccacact
gatgagccagttaaggttgcagaagtcccacaacctccaggaaaaataactgtggatgat
gtcaccagaaacagtgtctccttgagctggacaaagcctgaacatgatggtggcagtaaa
atccttcagtatattgtggaaatgcaagctaaacgcagtgagaagtggtcagaatgtgct
cgagtcaagtcccttgaagcagtaattaccaacctaactcagggagaagagtatcttttt
agagtggttgctgtaaatgaaaaggggagaagtgacccacggtctcttgcagttccaatt
gttgccaaagatctggtcattgagccagatgtaagacctgcattcaacagttatagtata
caggttggccaggatttgaaaatagaagtgccaatttctggacgtcctaagccaactatt
acctggactaaagatggtcttccactgaagcagactacaagaatcaatgtgactgattca
cttgacctcactgtactcagtattaaagaaactcataaggatgatggtggacattatgga
atcaccgttgctaacgttgtgggtcagaagacagcatccattgaaattataactctagat
aaacctgatcctccaaaaggacctgttaaatttgatgaagtcagtgctgaaagtataaca
ttgtcttgggaacctccattatatacagggggctgtcagatcaccaactacatagttcag
aagagagacacaactaccacagtatgggaagttgtttccgctactgttgccagaactaca
ctcaaagtaaccaaactgaaaactggtactgaataccaattcagaatattcgctgaaaac
agatacggacaaagctttgccttagaatctgagccgattgtagctcaatatccctacaaa
gaaccaggccctccaggcacaccatttgtcacagccatttccaaagactccatggttgta
cagtggcatgaaccagtcaataacggtggaagccccgtcataggttaccaccttgagaaa
aaggaaagaaacagtatcttgtggacaaaagtcaacaaaactattattcatgacacccag
tttaaagcagccaatcttgaagaaggcattgaatatgaattcagagtttatgctgaaaat
atcgttggtgtaggcaaagcaagcaagaattcagaatgctatgtagccagagatccctgt
gacccaccaggaaccccagaagcaataatagttaaaagaaatgaaatcactttacaatgg
accaaacctgcatatgatggtggaagtgtgattacaggttatattgtagagaaacgtgat
ttgcctgagggtcgctggatgaaagccagcttcacaaatgtcattgaaacccaatttact
gtgtcaggtcttactgaagatcaaagatatgaattcagagtccttgcaaagaatgcagct
ggtacaataagtaaaccctctgacagtactggaccaataactgccagggatgaggttgaa
ctcccaagaatttcaatggatccaaaattcagagacacaattgtggtaaatgctggagaa
acattcaggcttgaagctgatgtccatggaaagcccctccctaccattgagtggttaaga
ggagataaggaaattgaagaatctgctagatgtgaaataaagaacacagatttcaaggct
ttacttattataaaggatgccattagaattgacagtggacagtatatcttacgagcttcc
aatgttgcaggttctaagtcattcccagtaaatgtaaaagtattagatagaccaggacct
ccagaagggccagtccaggttactggagtcactgctgaaaaatgcactttaacatggtct
ccaccacttcaagatggtggcagtgacatttctcactatgttgttgaaaagagagaaaca
agtcggcttgcctggactgttgttgcttcagaggttgtaaccaattctctgaaaattacc
aaactcttagaagggaatgaatatattttccgtataatggctgtcaacaaatatggtgtt
ggagagcctttggaatctgcaccagtactaatgaaaaatccatttgtgcttcctgggcca
ccaaaaagcttagaagtcacgaacattgccaaggactccatgactgtctgttggaaccgt
ccagatagcgatggtggaagtgagattattggttacattgtagagaaaagagacagaagc
ggcattaggtggataaaatgtaataaacgccgcattacagatttgcgtctaagagtaaca
ggactaacagaagatcatgagtatgaattcagagtctctgcagaaaatgctgctggagtt
ggagaaccaagtccagctacagtttattataaagcttgtgatcctgtgttcaaacctggc
ccccccatcaatgcacacgttgtagacaccactaaaaattcaattacacttgcctggggt
aaacccatctatgatggtggcagtgagatcctgggctatgtagtagaaatctgcaaagca
gatgaagaagaatggcaaatagttactccacagactggcctgagagccagtcgatttgaa
atttccaaactcactgaacaccaagaatataaaatacgcgtctgtgccctcaataaagtt
ggtttaggtgaggctacctcagttcctggcactgtgaaaccagaagataaacttgaagca
cccgaacttgaccttgactctgaattaaggaaaggaatcgtcgtaagagctggtggatct
gtcagaattcacattccattcaaaggtcgcccaacacctgagatcacttggtctcgagag
gaaggtgaattcacagataaggtccaaactgaaaaaggagcaaactatacccagctgtca
atagataactgtgatagaaatgatgctggaaaatatattctcaagctagaaaacagcagt
ggatcaaaatctgcttttgtcactgtgaaagttctcgataccccagggccaccacagaat
ttggcagtcaaagacgtgaaaaaagactccgtccttctggtatgggaaccacccatcatc
gatgggggcgcaaaggtcaagaactatgttattgacaaacgtgagtcaaccagaaaagca
tatgctaatgtgagtaataaatgcagcaaaacaagctttaaagttgagaatcttacagaa
ggagccatctattactttagagtcatggctgaaaatgaatttggagttggtgtcccagtg
gaaactgttgatgctgtgaaagctgctgaacctccatccccaccaggaaaggttacgctc
actgatgtgtcccagaccagtgcatcgctgatgtgggagaaacctgaacatgatggtggt
agcagaatcctggggtatgtcgttgaaatgcagcccagaggaaccgaaaagtggagtgtt
gtggctgaatccaaagtctgtaatgcagttgttactggtttgagttctggacaagaatat
cagttccgtgtcaaggcttacaacgagaaaggacaaagcgatccaagggtgcttggtgtt
cccgtcatagccaaggacttgactataccacctacttttaagttaccatttaacacctat
actgtccaagctagagaagatcttaaaatcgaaattcctgtcattggccgaccaagacct
agtatttcatgggtcaaagatggtgagcctcttaaacagacgacaagagtaaatgttgag
gaaacagctacgtcaactattttgcacattaaagaaagcaacaaagatgactttggaaaa
tacaccgtaacagcaacaaacagtgcaggtacagcaacagaaaatctgagcattatcgtt
ttggaaaagcctggacctccagttggaccagttcggtttgatgaagttagtgcagatttt
gtggtcatatcttgggaacctccagcctatactggtggctgccagataagcaactacatt
gtagagaagcgagatacaactaccaccacttggcatatggtatcagcaacagttgcaaga
acaacaattaaaataaccaagctgaaaacgggcagtgagtaccagtttagaatttttgca
gaaaacaggtatggaaaaagtgcccccttggattctaaaccagttactgtacaatatcca
tttaaagaacctgggccacccggcactccttttgtgacatcagtctcaaaagatcaaatg
ctagtgcagtggcatgagccagttaacgatggaggcagcaaagttattggctaccatctt
gaacagaaagaaaagaacagcattctgtgggtcaaattaaataagactcccattcaagac
accaaattcaaaacaactgcgattgacgaaggcctggagtacgagttcaaagtttctgcc
gaaaacattgttggcattggcaagccgagcaaagtgtcggaatgctttgttgctcgtgac
ccatgtgacccaccaggtcgccctgaagccattgttattacaagaaacaatgtcacactg
aaatggaagaaacctgcctatgatggtggcagcaaaataacaggttatattgtagaaaag
aaagatctgcctgatggccgttggatgaaagccagctttaccaatgtattagaaactgaa
tttacagtgagtggccttgtagaagaccaaagatatgaatttagagtaattgcaagaaat
gcagctggcaactttagtgaaccatctgaaagcactggtgccattaccgcacgagatgaa
atcgatgcaccaaatgcctcgctggatccaaaatacaaagatctcatcgtggttcgtgca
ggagagacttttgtccttgaagctgacattcggggcaaacctatacctgatgttgtttgg
tcaaaagatggaaaagagcttgaagaaactgccgccaggatggaaattaagtctactatt
cagaaaacaactcttgtcgtcaaagactgtatacgtagtgatggaggacaatatattctg
aaactcagcaatgttggtggcataaagtctataccaatcactgtaaaggtacttgacaga
ccggggcctcctgaagggcctctgaaagtttctggggttactgctgaaaaatgttacctg
gcgtggaacccacctctagaagatggcggtgctagtatttcacattacatcattgaaaag
agagagacaagcagactctcctggacccaagtttcaactgaggtacaggcccttaactac
aaagtcactaaacttcttcctggtaacgagtacatcttccgtgtcatggctgtgaataaa
tacggaatcggagagcctctggaatctgagcctgttatagcccgtaatccttataaacca
ccaggtcctccttcaccacctgaagcctctgcaatcaccaaagattctatggtcgtgaca
tgggcacgccctgtagatgatggaggtgctgagattgagggctacattcttgaaaagcgt
gataaggaaggtgttagatggaccaagtgcaacaagaaaacactaacagatcttcgattc
agggtaactggccttactgaagggcactcctatgaatttagagttgctgctgaaaatgca
gctggtgtgggtgaacccagcgagccgtctgttttctatcgtgcgtgtgatgctttgtat
ccaccaggacccccaagtaatcccaaagtgacagacacttcgcgctcttctgtctccctg
gcgtggagtaagccaatttatgacggtggtgcacctgtaaagggctatgttgtggaagtc
aaagaagccactgctgacgaatggacaacctgcactccaccaacaggattacaaggaaag
cagttcacggtgaccaagcttaaagaaaatactgaatataacttccgtatttgtgccatc
aattctgaaggtgtaggagagcctgcaaccatacctggctcagttgttgctaaagagagg
caagagccaccagaaatagaactcgacgctgatctcaggaaagtggttgttctgcgagcc
agtacaacgttacgcttatttgtcactatcaagggtcgaccggaacctgaagtgaaatgg
gaaaaggccgaaggcattctcactgagagggcccagattgaggtgaccagctcatataca
atgttggtaattgataatgtcaccagatttgacagtggtcggtataatctgacactggaa
aataacagtggctctaaaaccgcttttgttaacgtcagagttctcgactcacccagcgcc
cctgtgaatctgactgtaagagaagtgaagaaagactcagtggtgttggcttgggaacca
ccacttattgacggtggagctaagatcacaaactacatcgtcgaaaaacgagaaacgaca
agaaaagcatatgctaccgttacaaataattgcaccaagaatactttcaaaattgaaaat
ctgctagaaggatgttcttactacttccgagtcttggcttgcaatgaatatgggattggt
ttgccagctgaaacaactgaaccggttaaagcttctgaaccacccctcccacctggaaga
gtaactcttgtggacgtgacccgtaacacagccacgattaagtgggagaaaccagaaagt
gatggtggcagcaaaattactggttacgtggttgaaatgcagactaaagggagtgaaaaa
tggagcatctgcacacaagttaagactctagaggcaactatatctggcctaagtgctgga
gaggagtataccttcagggtatctgccattaatgaaaaaggaaaaagtgacccaagacaa
ctgggagtgccggtaattgcaagggatattgagataaagccttcagttgagcttcctttc
aatactttcaatgtaaaggctagagaccaacttaagattgatgttccatttaaaggaaga
cctcaagctactgtaatttggaaaaaagatggtcaggctcttaaagagacaactagagtc
aatgtttcttcttccaagactgtaacatcactaactattaaggaagcttcaagggaagat
gttggaacttacgaattatgtgtttcaaacagtgctggatccctaactgttcctattact
gtaattgttcttgacaaaccaggacctcctggacctatacatattgatgaggttagctgc
gacaatataaccatttcttggaatcctccagaatatgatggtggctgccaaattagcaat
tacatcgttgaaaagagagaaaccacttctacagcatggcacgtagtttcacaagcagtt
gcaagaacatccattaaaattattcgtctgataacaggaagtgagtatctgttccgtgtt
tgtgcggaaaaccgctacggaaagagctcctacagtgaatcttcagccgttgtcgcagag
tatccattcagccccccaggtcctcctggtactcctaaagttgtgcatgccacaaaatcc
accatgatagtaacctggcaagtgccagttcatgatggaggaagtcaagtaattggctat
cacctggaatataaagaaagaagcagcattctttggtcaaaagcaaacaaaatgctcatc
gctgatactcaaatgaaagtctctggccttgatgaaggactgatgtatgagtatcgtgta
tatgctgagaatattgctggaattggtaagtgcagtaaatcctgtgaaccagtccctgca
agagacccttgtgaccctcctggacaacctgaagtcacaaatatcacaagaaaatcagtg
tcacttaaatggtctaaaccacattatgatggtggagctaagatcacgggatacattatt
gaacgccgagaactaccagatggtcggtggctgaagtgcaattatactaatgtccaagaa
acatactttgaagtaaccgaacttactgaagatcagcgttacgaattccgggtgtttgca
aagaatgctgctgactcaatcagtgagccatctgaatccactggacctattacagtcaaa
gacgatgttgaggctccaagaattatgatggatgtaaagttccgagctgtcattgttgtc
aaagctggagaggtccttaagataaatgcggacattgcagggcgacctctgccaataatt
tcctgggccaaggatggtgtagaaattgaagagagagcaagaacagaaataatctctaca
gactatgataccttgctaacagtgaaagactgtgtccgacgagactctgggcagtatgtg
ctaacactgaagaatgtcgcgggaactcggtctatggcagttaattgcaaggttctcgat
aagcctggcccaccagcaggaccacttgaaataactggcctcactgctgagaagtgctct
ctttcctggggaccacctcaagaagatggcggtgcagcaatcgactattacattgtagaa
aaacgtgagacaagccgccttgcttggacaatatgtgaaggagagttaaggacaacatcc
tgtaaagtaaccaagttactcaaaggcaacgaatacatctttagagtaacaggcgttaat
aaatatggtgtaggtgagccactagagagtgtggctgtaaaggcactagatccatttaca
gttccaagtcctcccacgtctttggaaattacatctgtgaccaaagagttcatgacactt
tgctggtcgagacctgagagtgatggaggcagtgaaatctctggatacataattgaaagg
cgagagaaaaacagcctgcgatgggtgcgtgtaaacaaaaaaccagtttatgatctgaga
gtgaaatccaccggacttcgggaaggatgtgaatatgagtatcgggtatatgcagaaaat
gctgctggcctgagccttccaagtgaaacctctcccttagttcgggcagaagatccagtg
ttcttaccatctcctccatccaaacccacaatcgtggactcaggcaagacaaatataacg
attagctgggttaagcccttatttgatggtgggtccccagtaaccggatacgctgtagaa
tacaaaaagtctgatgaaactgactggaaaactgccattcagaacttaagaggcacggaa
tttacaataagtggactaacaacaggaggcgaatacgttttcagagtaagatctatcaat
aaggtgggtgctagtgatcccagtgacagctccgatccccagatagcaaaggaaagagaa
gaagaacctgtatttgaccttgatagtgaaatgaagaagaccttgattgtcaaggccggt
gcctcgttcaccatgacggtacctttccgaggaagaccagtccccaacgtctcctggagt
aaaccagacactgacctccgcactagagcttacattgactccacagactctcgtacatca
ctgactattgaaaatgccaacagaaatgattctggaaaatacacattaacgattcagaat
attttgaatgctgcttcactgaccttagttgtcaaagttttagattctcccggttctcca
gccaatattactgtgcatgatatcaccaaagagtctgcagtgttatcctgggatgttcct
gaaaacgatggtggagcaccagtgaagaattaccacatagaaaaacgtgaggccagtaag
aaagcatgggtctctgtgaccaacaactgtaaccgcctctcctacaagattaccaactta
caagaaggggcgatttattacttcagagtctctggagaaaatgagtttggtgttggtgta
ccagccgaaacaaaggaaggagtaaaaataacagaaaaaccaagcccacctgaaaaactt
ggagtaacaagtgtatccaaagacagtgtttccctgacctggttgaagccagaacatgat
ggtggaagcagaattgtacattatatcattgaagcactagaaaaaggacagaaaaactgg
gttagatgtgccgtggtaaagtcaacccatcatgttatttctggtctgagggagaatgct
gagtactttttccgagtgtttgctgaaaatcaagctggtctgagtgacccaagagagctg
ctgcttcctgttctcgttaaggagaagctagaaccacctgaaatagacatgaagaatttc
ccaagccacaccgtctatgttagagctggttcaaaccttaaagttgacattccaatttct
ggaaaaccactgcccaaagtgaccttatcaagagatggtgtacccctgaaagcaaccatg
agatttaatactgaaattactgctgagaacctgaccatcaatctcaaagaaagcattgct
gctgatgctggaagatacgagatcacggccgccaactccagtggaacaaccaaagctttc
attaacatcgtcgtactggacaggcctggtcccccaactggccctgttgtgattagtgat
ataactgaacaaagtgtgactctcaaatgggagcctcctaagtatgatggcggaagtcag
gttaccaattacattgtactcaagagagagacaagtaccgcagcatggactgaagtgtct
gcaacagttgcaagaaccatgatcaaagtcatgaaactgaccacaggagaagaataccaa
ttccgcatcaaggcagaaaaccgctttggcatcagcgatcacatagattcagcttgtgtg
actgtcaaactaccatacacaacacctggaccgccatctacaccatgggtcactcatgtt
actcgagaaagcatcactgtgagctggcatgaaccagtgtccagtggaggcagtgcagtt
acaggatatcacctggaaatgaaagacagaaacagtatcttatggcaaaaagtcaacaaa
atggtcatccgcacaactcacttcaaagtcacaacgatcagtgccggacttatctatgaa
ttcagggtgtatgcagaaaatgctgctggtattggaaaacccagccatccttccgaacca
gtcctagccattgatgcctgtgaacccccaagaaatgtccgtatcactgatatttcaaag
aactctgtcaacctttcatggcaacaaccagcttttgatggaggaagcaagattacaggc
tacatcattgagagacgagatcttccagatggcagatgggccaaggccagctttaccaat
gtcaccgagactcacttcaccgtctctggcttgactcagaactcccagtatgaattccgt
gtctttgctagaaatgccgttggatccatcagcaatccatctgaggttgtaggtcccatt
acttgcgtcgattcttacggtggacctgtgattgatttgcctctagaatatacagaagtt
gtcaaatacagagcaggtacatctgtgaggctcagagctggcatttctggcaaacctgag
cctacaattgagtggtataaagatgataaagagttacaaaccagtgcactggtgtgtgtt
gaaaataccactgaccttgcatctatactcatcaaagagacaaatcgccttaatagtgga
agctatgaattaaaactaaggaatgccatgggttcagcctcagccactatcagagtgcag
atccttgacaaaccaggacctccaggtggaccaattgagtttaagaccgtcaccgccgaa
aagataactcttctctggcagcctccagcggatgacggtggtgccagaatcactcactac
atcgtggagaagcgtgaaacaagccgcgtggtgtggtctatggtgtccgaacatttggaa
gagtgcatcattacaaccaccaaaattatcaaaggaaatgaatacgtcttccgggttcga
gctgtgaacaaatatggaattggtgatccactggaatctcatccagtggtagcaaagaat
gcattcgttacacctgggcctccaagcgtgccagaggtgacaaagattaccaagaattca
atgacagttgtctggagcaggccagttgcagatggcggtagtgaaataagtggctatatc
cttgagaaacgagacaagaagagtctgggatggtttaaagtcctaaaggagactatccgt
gacaccagacagaaagtgacaggactcacagaaaacagtgactatcaataccgtgtttgt
gctctaaatgctgctggacatggtccattttctgaaccatctgacttctacaaagctgcc
gatcctattgatcctccaggcccaccagctaagataagaattgcagattcaactaaatca
tccatcactcttggctggagtaaacctgtctatgatgggggcagtgctgttaccggatat
gtcgttgcgatgagacaaggagaggaagaggaatggactgttgtctctgccaagggagag
gtcagaactacagaatatgtggtatctaacctgaagcccggagtcaattactacttccag
gtatccgcggtaaactgtgctggacaaggagaacctatagaaatgactgaacccgcacaa
gctaaagatatacttgaggaaccagagatcgacctggatgtggctctcaggacctccatt
atagctaaagctggtgaagatgtgcacgtgtttattcccttcaaaggcagacctcctcct
actgtcacatggagaaaagatgagaagaatcttggcagtgacgccagatacagcattcaa
aacactgattcatcttcactactcattattccccaagtcactcgcaatgatacaggcaaa
tatatcctcacaatagaaaatggagttggtcaaccaaagtcttcaactgtgaatgttaaa
gtgcttgacacaccagctgcttgccagaaactacaggttaaacatgtttctcgaggcaca
gtcactttgctttgggagcctcctctcattgacggaggatctcccatcatcaattacatc
attgagaagagagatgccaccaagagaacatggtcttcagtgtcacacaaatgttccagc
acatcctttaaggtgacagatttgtcagagaaaactccattcttcttcagagttcttgca
gtaaatgaaattggaatcggggaaccctgtgacactacagagccagtgaaggctgctgaa
gtaccagctcctatacgcgacctctcagtgaaagattcaacaaagacatctgttacgctg
acctggaccaagcctgactttgatggtggtagtgtcatcacagactacatcgtggaaagg
aaaggcaaaggcgaacaagtgtggtcacatgctggcataactaagacatgtgaaatagag
gttagccaactcaaggaacagtcagtcctggaattcagagtgtctgccaaaaatgagaaa
ggactgagtgatagtgtcactattgggccaattacagtgaaagaacttgtgattacacct
gaagttgacctgtcagaaatccctggagcacaggtcagtgtgagaattgggcataatgtg
cacctcgaattaccttataaaggaaaacccaaaccatctatcagttggttaaaagatggt
ttgccactgaaagagagtgaacgtgttcgtttaagtaaaactgaaaacaaacttactttg
agtattaagaatgctaagaaggagaatggagggaaatacaccattatccttgataacgca
gtttgtagaaactcatttcccattacaatcatcacacttggcccaccatcaaagcccaaa
ggacccattcgattcgatgaagtcaaggctgacagtgtcatcatgtcatgggatgtgcct
gaagatgatggaggaggagaaattacttgttacagcattgagaagcgagaagcttcacaa
actaattggaagatggtgtgttcgagcgtggcccggacaactttcaaagttcctaatctg
gtcaaagatgctgaataccagttcagagttagggcagaaaacagatacggagtcagcgag
ccacttgtgtcaaaccttattgtggcaagacatcagttcaggattcctggccccccagga
aagccagttacatacaatgtaacttctgatggcatgtcactaacttgggatgctccagtt
tatgatggcggctcagaagttactggataccatgttgagaagaaagaaagaaatagcatc
ctctggcaaagacttaatacatcaccaatatctggaagagaatatagagctactggacta
atggaaggcctggattaccagttccgtgtatacgctgaaaattctgccggcctaagctca
cctagtgacccaagcaaatttaccttggctgtttccccagtagacccacctggcactcct
gactacattgatgtcacccgggaaaccatcacacttaagtggaacccaccgttgcgtgat
ggaggcagtaagattgtggcctacagcattgagaaacggcaagggagcgatcgctggact
cgatgcaactttaccgatgtcagcgaatgtcagtacacggttacaggacttagtcctggg
gatcgatacgagttcaggataattgcaagaaatgctgttggaactataagcccgccctca
cagtcttctggcgttattatgacaagagatgaaaatgttccaccaatagtagagtttggc
cctgagtactttgatggtgtcactattaagtctggagagaatctcagaattaaagctttg
gtgcaaggacgaccagtacctcgagtaacttggttcaaagatggagaagaaattgaaaag
aagatgaaaatagaaataacagatgtccttggatccaccagcatctttgttagagatgct
actcgggaccatcgtggtgtatacacagtggaagccaaaaatgcatctggctccacaaag
gcagaaattaaagtgaaagtacaagatacaccaggagaaccagttgggccaataagattc
accagtattactggagagaagatgaccctgtggtgggatgctccactgaatgacggctgt
gctcctgtaactcactacatcattgaaaaacgggaaaccagcagacttgcttgggcacta
attgaggataattgtgaaggccacagctatactgccagtaaactaataactggcaatgaa
taccaattccgtgtttctgcagttaataaatttggtgttggcaggccactggattctgac
ccagtggttgctcaaatacagtacactattcccgatgcccctggcactccagaacctagt
aacataacaggcaatagcattaccctgacatggacgaggccagaatcagatgggggcaat
gaaatccaacagtatatcctcgaaaggagagaaaagaagagcactcgatgggtgaaagtg
atcagcaaacgaccaatctgtgagacaagattcaaagtcaccggtctgaccgagggcaac
gagtatgaattccatgtcatggctgaaaatgctgcaggagtaggacctgccagtggcatc
tcaagactaatcaaatgtagagaaccagtcagcccacccagtgctcccactgtggtcaaa
gtgacagacacatcaaagacaactgtgagcttagaatggtccaagccagtgtttgatgga
ggcatggaaataattgggtatattattgaaatgtgcaaagctgacttaggagactggcac
aaggtgaatgtagaagcatgtgtgaagacaagatacacagtcaccgatctacaagctgga
gaagaatacaaattccgggtgagtgctgtcaatggtgctggaaagggagacagctgtgaa
gtgaccggcaccattaaagctgttgaccgattaacagctcctgagttagacatcgatgcc
aacttcaagcagactcatgttgtcagggctggggccagtattcgcctcttcattgcctac
tctggtagaccaactccaacagccgtgtggagcaaacctgactcaaaccttagcattcgg
gctgatatccatacaacagactccttcagcaccctcactgtggaaaactgcaacagaaat
gatgcagggaaatacacctttaccgtggaaaacagcagtggtagtaagtcaatcacattc
attgtaaaggtgctagactctccaggcccacctggcccaattaccttcaaggatgtgacc
cggggatctgttacattgatgtgggatgcccctctccttgatggtggtgcccgaatccat
cactacgtggtagagaaacgagaagcaagtcgccgtagctggcaggtggtcagtgaaaaa
tgcactcgccagatcctaaaggtcaacgacctggtagaaggcgttccatattatttccgt
gtttctgcagaaaatgagtatggtgttggggaaccctatgagatgccagaaccaatggta
gccacagaacagcctgctccacctaagagactcgatgttgttgacacaagcaaatcctct
gcggtattagcttggcttaaacctgaccatgatggaggcagccgaatcactggctacctg
ctggaaatgagacaaaagggatctgacttctgggttgaggctggtcacaccaaacagctg
actttcacagtggagcgcctcgttgagaacactgaatatgaattccgtgtgaaggccaag
aatgacgctggctacagtgaacccagggaagccttctcttcggtcatcatcaaggagcct
caaattgagcccactgctgatctcactggaattaccaatcagctcataacttgcaaagca
ggaagtacatttaccattgatgtgccgatcagtggtcgtcctgcccccagagtaacatgg
aagcttgaagaaatgagacttaaggagacagatcgagtgagtatcacaacaacaaaagac
agaaccaccctgtctgtaaaggacagcatgagaggtgactctggaagatacttcttgacc
ctggaaaatacagctggtgttaaaacattcaccgtcacagttgtggtcatcggaagacca
ggtccagtaaccggccccatcgaggtctcatctatctcagctgaatcatgtgtcctatcc
tgggctgaacctcaagatgatggaggcaccgatattactaattacatagttgaaaagcgt
gagtcgggcacaacagcttggcagctcgtcaattccagtgtcaagcgcactcagattaaa
gtcactcatcttacaaaatacatggaatattctttccgtgtcagttcagagaacagattt
ggtgtcagcaagcccctagaatcagcaccagtcattgctgagcatccatttgtcccacca
agtgcacctaccagacctgaggtctactacgtgtctgccaatgccatgtctattcgctgg
gaagaaccctaccatgatggtggcagtaaagtcattggctattgggttgagaagaaagaa
cgtaacaccattctttgggtgaaagaaaacaaagtgccatgcttagagtgcaactacaaa
gtgaccggtttggtagaaggactggaatatcagttcagaacgtacgcactcaatgccgca
ggtgttagcaaagccagcgaagcttcaagacctatgatggctcaaaacccagttgatgca
ccaggaagaccagaggtgacagatgtcacaagatcaacagtatcactaatttggtctgcc
cccgtgtatgacggaggcagcaaggtcgtgggctatatcatagagcgaaagccggtcagt
gaagttggagatggtcgctggctgaagtgcaactataccatagtatctgacaatttcttc
accgttactgctctcagcgaaggagatacctacgaattccgtgtattagccaagaacgca
gcaggcgtaatcagcaaaggatcagaatctacaggccccgtcacttgccgagatgaatac
gctccacccaaagccgaactggatgccagattacagggtgatctggttaccatcagagca
ggctcggatcttgtcctcgatgccgcagttggtggcaaacctgaacccaaaattatctgg
accaaaggagacaaggaactagagctctgtgaaaaagtctctttgcagtacactggcaaa
cgagcaactgctgtgatcaagttctgtgacagaagcgacagtggaaaatacactttaaca
gttaagaatgccagtgggaccaagtccgtgtctgtcgtggtcaaagttcttgattcccct
ggcccatgtggaaagctcaccgtcagcagagtcacagaggagaagtgcactttggcctgg
agccttcctcaggaagatggaggagcagaaataactcactaccttgtggaaagacgcgag
actagcaggctcaactgggtgattgttgaaggcgaatgcccaaccctatcccatgtagtt
actagactcatcaagaacaacgaatacatattccgagtgcgggcagtaaacaaatacggc
cctggtgtgcctgttgaatcagagccaattgtggccagaaactcattcactattccatca
caacctggcatacctgaagaagtcggggctggcaaggagcatatcatcattcagtggaca
aaacctgaatctgatggtggcaatgagatcagaaactacctcgtagacaaacgtgagaag
aagagcttgcgctggacacgtgtcaacaaggactatgtggtgtatgataccaggctgaag
gtgactagcctgatggaaggttgtgattaccagttccgggtgaccgcagtaaatgctgct
ggtaacagtgaacccagtgaagcatccaactttatctcctgcagagaaccatcatatacc
cctggaccaccttctgctccaagagtcgtagataccaccaaacacagcatcagtttagcg
tggaccaagcccatgtatgatggtggcactgacatcataggatacgttcttgaaatgcaa
gagaaggatactgatcagtggtaccgagtgcataccaaggccacaataagaaataatgaa
ttcactgtgacagaccttaaaatgggccagaaatactccttcagagttgcagctgtgaat
gtgaagggtatgagtgaatacagcgagtcaactgccgaaattgagcccgtggaaagacta
gaaataccagatcttgagcttgcagatgatttaaagaagactgtgaccatcagagctggg
gcttcattgcggctgatggtgtctgtatctggaagaccacctcccgtcatcacatggagc
aagaagggcattgaccttgcaagccgggcgatcattgacaccactgagagttactcttta
cttattgtggacaaagttaaccggtacgacgctggcaaatacaccattgaagccgaaaat
caatccggcaagaaatcagcaacagtccttgttaaagtatacgatactcctggtccctgt
ccttcagtgaaagttaaggaagtatcaagagattctgtgaccattacttgggaaattccc
acaattgatggtggagctcctgtcagcaattacattattgagaagcgtgaagctgccatg
agagcattcaaaacagtaactaccaaatgcagcaagacactctacagaatctctggactc
atagaaggaaccatgtactatttcagagtgttgccagaaaatatttatggcattggagaa
ccctgtgaaacatctgatgcggttctggtctcagaagtgcctttggcacctacgaagcta
gacgtggtcgatgtcaccaaatcaactgttagccttgcctgggaaaaaccactctacgac
ggtggcagccgactcactggatatgttcttgaggcctgcaaagctggcactgagagatgg
atgaaggttgtcaccttgaaacccaccatcctagagcacactgttatttccttaaatgaa
ggtgaacagtacttatttagagtaagggcacaaaatgagaaaggtgtgtcggaacctaga
gagatcgtcacagctgtgaccatacaagacctcaaagtgctgccaacaatcgatctttct
acaatgcctcaaaagaccgtccatgtcccagccggcagaccagtggagctggtgataccg
atcgctggtcgcccaccacctaccgcttcctggttctttgctgggtctaaactaagagaa
tcagagcgtgtcacagttgaaactcgcactaaggtagccaagttaacgatccgtgaaacc
actatcagagatactggagaatatatacttgaattaaagaatgcaactggaactacttca
gagaccattaaagttatcattcttgacaagcctggtccaccaactgggcctatcaagatt
gatgaaattgatgctacttcagttaccatttcttgggaaccacctgaactggatggcggt
gctccactgagtggttatgtggtagagcaacgtgatgcccatcgtccaggatggctgcca
gtgtctgaatcagtgactagatcaacctttaagtttaccagactcattgaaggaaatgag
tatgtgttccgtgtggctgcgaccaaccgcttcggaattggctcctacttgcagtctgag
gtcatagaatgtcgcagcaggatcagtattcctgggcctccagaaacattacagatattt
gatgtctcccgtgatggcatgacacttacctggtacccaccagaagatgacggtggcgcc
caagtaactggatacattgtggagcgcaaagaagtgagagcagaccggtgggtccgggta
aataaagtaccagtgacgatgacgcggtaccgttccactggccttattgaaggcttagaa
tatgaacaccgtgtcacagccattaacgcgagaggaagtggaaaaccaagccgtccttcc
aaacccaccgttgccatggatccaattgctcctccaggaaagccacaaaacccaagagtt
actgatacaacaaggacatcagtctccctggcttggagtgtcccagaagatgaaggcgga
tctaaagtcacaggctacttgattgaaatgcagaaagtagatcaacatgaatggaccaaa
tgtaataccaccccaaccaagattcgggagtatactctaacacacctacctcagggcgcc
gaatacagattccgtgtcctagcttgtaatgctggcggacctggggagcccgctgaggtg
ccaggaacagtcaaagtcactgaaatgcttgaatatcctgattatgaacttgatgaaaga
taccaggaaggtatctgtgtaagacaaggtggggtcatcagacttaccataccaatcaaa
ggaaaaccattcccaatatgtaaatggaccaaggaaggccaagatattagcaagcgtgcc
atgattgccacctctgaaacacacactgagcttgtaatcaaagaagcagacagggatgat
tctggcacttacgacctggttctggaaaacaaatgtggcaagaaggctgtttacatcaag
gtcagggtgataggaagtcccaacactccagaagggccacttgaatatgacgacatacaa
gctcgctctgtgagggtcagctggagagcccctgccgatgatggtggtgccgacatccta
ggctacatcctcgagaggcgagaagtgcctaaagccgcctggtatactatcgattccaga
gtccggggtacatctctggtggtaaaaggcctcaaagaaaacgtggaataccatttccgt
gtttcggcggaaaaccagtttggaataagcaaacccttgaaatcggaggaaccagtcata
ccaaaaacaccattgaaccctccagagcctccaagcaatcctccagaagtactcgatgtg
accaagagttctgtcagcctatcctggtcccgacccaaagatgatggtggttctcgagtc
acaggctattacattgaacgcaaggagacatcaactgacaaatgggtcagacacaacaag
actcagatcaccaccacaatgtacactgtcaccgggctcgttcctgatgctgagtatcag
ttccgcatcatcgcacagaatgacgttggcctgagcgagaccagccctccctctgaacca
gttgtttgcaaagatccatttgataagccaagccagcctggagaacttgagattctttca
atatccaaagacagcgtcaccctacaatgggagaaacctgaatgtgatggtggcaaagaa
atccttggatattgggttgaatatagacaatctggagacagtgcctggaagaagagcagt
aaggaccgcatcaaagacaggcaattcacagtcgggggtttgctagaagccactgaatat
gaattcagggttttcgctgagaatgagacagggctgagcagacctcgaagaactgctatg
tctgtaaagacgaaactaacatctggagaagccccaggagtacgcaaagaaatgaaagac
gttaccaccaaactgggcgaagcagctcagctgtcgtgccagattgttgggaggccccta
cctgacattaaatggtaccgatttggtaaggagctcatacaaagccggaagtacaaaatg
tcttcagatggacgcacacatactctgacagtaatgacagaggaacaagaagatgaaggt
gtttatacttgcatagccaccaatgaggttggagaagtagaaaccagcagcaagcttctc
ctgcaagccacaccacaattccatcccggttacccactgaaagagaaatattatggtgct
gtgggctccacccttcgacttcatgttatgtacattggtcgtcccatacctgccatcact
tggttccacggccagaaacttttgcaaaactcagaaaacattactattgaaaacactgag
cactacactcatctcgtcatgaagaacgtccaacgcaagactcatgctgggaaatacaag
gttcagctcagcaacattcttggaacagtggataccatccttgatgtggaaatacaagat
aaaccagacaaacctacaggaccaattgtgattgaagcactattgaagaactctgtggtg
atcagctggcaaccacctgcagatgacggaggctcctggatcaccaattacgtggtggag
aagtgtgaggccaaggaaggggctgaatggcaattggtgtcttcagccatctcagtgaca
acctgtagaattgtgaacctcacagaaaacgctgggtattacttccgggtttcagctcag
aacacttttggcatcagtgatcctctagaagtctcctcagttgtgatcattaagagtcca
tttgaaaagccaggtgctcctggcaaaccaactattactgctgtcaccaaagattcttgt
gttgtggcctggaagccacctgccagtgatggaggtgcaaagattagaaattactacctt
gagaagcgtgagaagaagcagaataaatggattgctgtgacaacagatgaaattcgagaa
accgtattttcagtgcaaaaccttattgaaggtcttgaatatgagttccgtgtgaaatgt
gaaaaccttggtggggaaagtgaatggagtgaagtatcagaacctgtcactcccaaatct
gatgtccccattcaggccccacactttaaagaggaactgagaaatctaaatgtcagatat
cagagcaacgctacattggtctgcaaagtgactgggcatccgaaacctattgtgaaatgg
tacagacaaggcaaagaaatcatcgcagatggattaaagtacagaattcaagagtttaag
ggtggctaccaccagctcatcattgcaagtgtcacagatgatgatgccacagtttaccaa
gtcagagccaccaaccaaggaggatctgtgtctggcactgcctccttggaagtggaagtt
ccagccaagatacacttgcctaaaactctggaaggcatgggagcagttcatgctctccga
ggtgaggtgatcagcatcaagatccctttcagtggcaaaccagatccagtgatcacctgg
cagaaaggacaagatctcattgacaacaatggccactaccaagttattgtcacaagatct
ttcacgtcacttgtcttccccaatggagtggagcgaaaagatgctggtttctatgtggtc
tgtgctaaaaacagattcggaatcgatcagaagacagttgaactggacgtggctgatgtt
cccgacccaccccgaggagtcaaagttagtgacgtctcacgagattctgtcaacttaaca
tggactgagccggcttcagatggcggcagcaaagtcaccaactacattgttgaaaaatgt
gcaactactgcagaaagatggatccgtgtaggacaggcccgagaaacacgttatactgtc
atcaacttatttggaaaaacaagttaccagttccgtgtaatagctgaaaataagtttggc
ctgagcaagccttccgagccttcagaaccaaccataaccaaagaagataagaccagagca
atgaactatgatgaagaggtagacgaaacccgggaagtttctatgactaaagcgtctcat
tctaaaaccaaggaactctacgagaaatacatgattgccgaagatcttgggcgtggtcag
tttggaattgtccaccgttgtattgagacctcctcaaagaaaacatacatggccaaattt
gttaaagtcaaagggactgatcaggttttggtaaagaaagaaatttccattctaaacatt
gctaggcaccgcaacatcttatacctccatgaatcatttgaaagcatggaagaattagtt
atgatctttgagttcatatcaggacttgacatatttgaacgcattaacacgagtgctttt
gaacttaatgaaagagaaattgtaagttatgttcgccaggtctgcgaagcacttgagttc
ttacacagtcataatattggaaactttgacatcagaccagaaaatatcatttaccagaca
agaaggagctccatcattaaaatcatagaatttggtcaagcccgtcagctgaagccaggg
gacaactttaggcttctgttcactgcccctgaatactatgcacctgaagtccaccagcat
gatgttgtcagcacagccacagacatgtggtcacttggaacactggtgtatgtgctgttg
agtggtatcaatccattcctggctgagactaaccaacagatgattgagaacatcatgaat
gcagaatatacttttgatgaagaggcattcaaagagatcagccttgaagccatggacttt
gttgaccggctgttagtgaaagagagaaaatctcgcatgacagcctctgaggccctccag
cacccatggctgaagcagaagatagaaagagtcagtactaaagttatccggacattgaaa
caccgacgttactaccacaccctgatcaagaaagacctcaacatggttgtgtcagcagcc
cggatctcctgtggtggtgcagttcgatctcagaagggagtgagcgttgctaaagttaaa
gtggcatccattgaaatcggcccagtttctgggcagataatgcatgcagtcagtgaagaa
ggaggatatgtcaaatacgtatgcaaaattgaaaattatgatcagtctacccaggtgact
tggtactttggtgtcagacagctggagaacagtgagaaatatgaaatcacctatgcggat
ggagtggccaccatgtatgtcaaagacattaccaaattcgatgacggtacctacagatgc
aaagtagtcaatgactacggagaagacagttcttatgcagagctgtttgttaaaggtgtg
agagaggtttacgattattactgccgtagaaccatgaggaaaattaagcgcagaacagat
accatgagactcctggaaaggccaccagaattcaccctgcctctctataacaagacagct
tacgtgggtgaaaatgtccggtttggagtaactataactgtccatccagagcctcgtgta
acatggtataaatcaggtcagaaaataaaaccgggtgaggatgataggaagtacacattt
gagtcggacaagggtctttaccaattaacaatcaacagcgtaactatagaagatgacgcc
gagtacactgtcgtagcaaggaacaaatacggcgaagacagctgcaaagcaaagctgact
gtaaccccacacccacctccaacagacacaaccttaagacccatgttcaaacggctactg
gcaaactcagaatgccaagaaggccaaagcgtctgctttgagatcagagtgtctggcatc
cccccgccgacattaaagtgggagaaggatggtcatcctctgtccctcgggcccaacatt
gaaattatccatgaaggcttggattattatgctttgcacatcagggacactttgcctgaa
gacacgggttattacagggtcacagccacaaacacagctggatccaccagctgccaggcc
cacctccaagtggaacgcttgaggtatgtcaagcaggagttcaagactgaggaggagcga
gaacgacacgtccagaggcaaattgacaagacgctaaggatggctgaaattctttctgga
acagaaactgtgccactgacccaggtggcccaggaggcgctgagagaagctgctatcctt
tacaaaccagctgtgagcaccaagactgtaaaaggcgaataccgcctcgagacagaagaa
aagaaggaggagagaaaactccgtatgccttacgaagtaccagagccacgcaagtacaaa
cagaccaccgtagaagaagaccaacacatcaagcagttcgtgcccatgtctgacatgaaa
tggtacaaaaagatccgtgatcaatttgaaatgcccgggaagattgacagaatcgtacag
aaaagaccgaagcgcatccgcctttcaagatgggaacagttctacgtgatgcctcttcct
cgcatcacagatcaatacagacctagatggcggatccccaaactgtcccaagatgatctt
gaaatggtgagaccagcccgccggcgtacaccttctcctgattactacttttactacaga
ccaagaagacgttctcttggggacatttcggacgaagagttactcctccccattgacgac
tacctggcgatgaagagaacagaggaggagaggctgcgtctggaagaagagctggaactg
ggtttttcagcttcccccccaagccggagccctccacgttttgagctttcgagtctgcgt
tactcttcaccacaagctcatgtcaaaatggaggaaacaaaaaaagacttcagatactca
acctatcacatcccaaccagggaggagaccagcacaagttacgcggagctgcgggagcgg
cacgcccaggcctcgtaccggcagcccagacaacggcagagaatcatggctgagagagag
gacgaagagctgctgcgtccagtcactgccacccagcggctctcagagtacaaaagcgag
ctggaccacatggcgagggaagaaaaatcaagaaagaaatcgcgacggcagagagaagtg
actgaaattacagaaattgaggaagaatacgagatctcaaaacacgctcatagagagaca
tcctcctcggtgtccaagctcctgaggcgacggcgctccctgtctccaacatacatcgag
ctaatgaggccggtgtccgagctgatccggacccgtccacagccagctgaggagtatgag
gacgacacagaaaggaggtcacccaccccagagaggactcgcccacgctcccccagcccc
gtgtcgagtgagcgatcactgtcaagatttgagaggtctgcaagatttgatatcttttcc
aggtatgagtccatgaaagctgctttaaaaactcagaagacatcagaaaggaaatacgag
gttttgagtcagcagccttttacgctggaccatgcccctcgaatcacactgaggatgcgc
tcccacagggtaccctgtggccaaaacacacgttttatcttaaacgttcagtctaagcca
actgccgatgttaaatggtaccacaatggtgtagaactccaagaaagcagcaagatccat
tataccaacatgagtggggtcctgaccctggaaattctagactgtaatattgatgacagc
ggaacataccgtgccgtgtgcaccaactacaaaggtgaggcttctgactacgcgaccttg
gatgtcacgggaggggattacaccacctacgcatcccggcgcagagatgaagatgtcccc
caatctgtcttccctgagctgacaagaacagaggaatatgcagtctcatcatttaagaaa
acatctgagatggaagcttcctcttcggtcagggaaatgaagtcacagatgacagagacc
agggaaagtctctcgtcttatgaacactatgcatccgcagaaatgaaaagtgctgcagtg
gaagaaaagtcgctggaagaaaaatccacacacagaaagattaagacgactttagcagcg
agaattctcacgaagccaaggtccataaccgtctacgaaggcgagtctgcaaggttttct
tgcgatacagatggtgagccagtaccaactgtgacgtggctgcgtgggggacaagtcata
agcacttcggcccgccaccaagtgaccagcacaaagtacaaatcaacctttgagatctct
gcagtccaggcttccgacgagggcagttacagcgtggtggtggaaaacagtgaaggcaag
caagaggcacattttactctgaccattcagaaggccagggtcactgaaaaggctatgaca
tcaccacccagagtgaaatccccggagcctcgggtaaaatccccagaaagagttaagtct
ccaaaacgagtgaaatccccagaaccggtcacttctcacccaaaagccgtattgcccaca
gagacaaaacccacaccaacagagaaagtgcagcagcgaccagtcgctgccctacccaag
ataactcagtccctgagagcagaagcttctaaagatacagcaaagctgacctgtgcagtc
gaaagtagcgtattatgtgtaaaagaggttgcctggtataaagatggcaagaaactgaag
gaaaatgggcatttccagtttcatcattcagcagacggtacctgtgagctcaaaatcctt
aacctcaccgaatctgactgtggagaatacgtttgtgagatttcaggtgaaggtggaact
tccaaaaccaacttccagtttaggggacaagccttcaagagtgtacatgagcaggtgtca
agcgcgtcagaagccaagaaagcggctcagaaaactgctgagtcagcagaaaccaagaaa
gcagttcccaaaactgctgagctaatcgaaaccaagaaaactgaaccaaaagctcctgaa
ccaatttcctcaaaaccagtcattgttactgggctgcaagatacaactgtttcttcagac
agcactgctaaatttgcagttaaagctactggagaaccccagccgactgtcatctggaca
aaggatggaaaggctataacacaaggaggtaaatataaactctctgaagacaaaggagca
ttcttcctagaaattcacaagactgatacttctgacagtggactttatacttgtacaata
acaaattcagctggatctgtgtcctccagctgcaaattaacaataaaagttgtaaaagac
actgagatacagaaagtatctacacaaaagagctcagaaattacatcccagaagaaggca
gctgtccaagaggaagtttcccaaaaagctctaatttctgaagaaatcaagatgtcagag
gtcaaatctcaagaaaagctagccctcaagcaggaatcttcaaaggctatgatttccgaa
aaagtcaagaaatcagaagcgacctccctggaaaaatccatcgtccacgaggaaatcaca
aaaacatcacaggcttctgaagaaatcagaacacatgaaattaaagcattttctactcag
atgagtgtaactgatggtcagaaggtgactttaaaagccaacatcgctggcgccaccgac
gtaaaatgggtattgaatggggtagagctcactaactccgaggagtacagatatggtgtc
tcgggtagtgaccagaccctgaccatcaagcaggctggtcataaagatgaaggtgtcctc
acctgcataggcaaaaccagccaaggaatcatcaagtgtcagtacgacttgaccctgagc
aaagaactctcagatgctccagccttcatctcacagcccaggtctcaaaatgttaatgaa
ggacaaaatgttctcttttcttgtgaaatcagtggcgagccatccccagaaattgaatgg
tttaaaaacaacctgccaatttctatttcttcaaatatcagcgtaagtcgctccagaaac
gtatattctcttgaaatccgaaacgcatcagtaagcgacagtgggaagtatacaattaag
gccaaaaatttccgtggccaatgttcagctactgcttccttaacagtgcttcctctagtt
gaagaacctcccagagaggtagtattgaggacaagtggcgaaacgagcttgcaaggaagc
ttctcgtctcagtcagtccaaatgtctgcctccaagcaggaggcctccttcagcagtttc
agcagcagcagcgctagcagcatgactgagatgaaatttgcaagcatgtctgcccaaagc
atgtcctccatgcaagagtcatttgtaggaatgagttccagcagttttatgggaaaatct
agtatgacacaactggaaagttcaactagtaggatgcttaaagcaggcgtaagaggaatt
ccacctaaaattgaagcccttccccctgacatcagcattgatgagggcaaagttttaaca
gtagcctgcgcttttacgggtgagcctaccccggaaataacatggtcccgcggtggaaga
aaaattcaaaatcaagaacaacaagggagattccatattgaaaacacagatgacctgacg
actctgatcatcatggacgtacagaaacaagacggtggactctataccctgagcttaggg
aatgaattcggatctgactctgccactgtgaatataaacattcgatccatttaa

DBGET integrated database retrieval system