KEGG   Camelus dromedarius (Arabian camel): 105099112Help
Entry
105099112         CDS       T04642                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105099112 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 105099112
NCBI-ProteinID: XP_031296917
Position
28
AA seq 1358 aa AA seqDB search
MDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITD
LVKNTKGNALKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYLQRPSTEQLLKHPFIRDQPNE
RQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRD
FLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREARRQQDREQRRREQEEKRRLEDAERRRAEEEKRRVEREQEYIRRQLEEEQRHLELLQ
QQLLQEQAVLLECRWREMEEHRQAERLQWQLQQEQAYLLSLQHDHRRPHPQPPQPPPPQE
RTKPSFHAAEPKAHHEPAERAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSN
GNSECVHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPPKFAHHHLRSQDPCPP
SRSEVLSQSSDSKSEVPEPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQ
NSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVR
SSSKSEGSPSQRLENAAKKPEDKKEVFRPLKPAGEVDLTALAKELRAVEDVRPPHKVTDY
SSSSEESGTTDEEDDDVEQEGAEEPGSGPEDPRAASSLNLSNGETESVKTMIVHDDVESE
PAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSPSSS
QPTPTMSPQTPQDKLTTNETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVG
FSCDGMRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLL
VGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNK
ILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMA
FKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHVRKNPHSM
IQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQ
TMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKQQEHFCRWGPRASKPQLTPS
FSHPDHILVLPGTCSLPPTASSGVERTAGWDADTLGLF
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcactgaggatgaagaggaagaaatcaaactggagataaatatgctgaagaaa
tattctcaccatagaaatattgcaacgtattacggtgctttcattaaaaagagcccccca
ggacatgatgaccagctgtggctcgtcatggagttctgcggggctgggtccatcactgat
ctcgtgaagaacaccaagggcaatgcgctcaaggaggactggatcgcctacatctccagg
gagatcctgaggggcctggcacatctccacatccatcacgtgattcaccgggacatcaag
ggccagaatgtgctgctgacggagaacgcagaggtgaaacttgtcgattttggggtgagt
gctcagctggacaggactgtcgggaggagaaacacgttcattgggaccccctactggatg
gctcccgaggtcatcgcctgcgacgagaacccggatgccacctacgattacagaagtgac
ctgtggtcttgcggcatcaccgccatcgagatggcagaaggcgctccccctctctgtgac
atgcatccaatgagagcgctgtttctcatccccagaaaccctcctccccggctgaagtcc
aaaaaatggtcaaagaagttttttagttttatagaagggtgtctggtgaagaattacctg
cagcggccctccactgagcagcttttgaaacatcctttcataagggaccagccgaatgaa
aggcaagttagaatccagcttaaggaccacatagaccggaccagaaagaagaggggagag
aaagatgagactgagtacgagtacagcgggagtgaggaggaggaggaggaggtgccggag
caggagggggagcccagctccatcgtcaacgtgcccggtgagtccacgctccgtcgggac
ttcctgcggctgcagcaggagaacaaggagcgctcggaggccctgcggaggcagcagctc
ctacaggagcagcagctccgggagcaggaggagtacaagcggcagctgctggccgagagg
cagaagcgcatcgagcagcagaaggagcagaggcggcggctggaggagcaacaaaggaga
gagcgggaggcccggcggcagcaggaccgagagcagcggcgacgagagcaggaggagaag
aggcgtctggaggatgcggagcggagacgggccgaggaggagaagcggagggtggagaga
gagcaggagtatatccggcggcagctggaagaggagcagcggcatctggaactccttcag
cagcagctgctccaggagcaggccgtgctactggagtgccgctggcgggagatggaggag
caccggcaggccgagcggctccagtggcagctgcagcaagaacaagcctatctcctgtct
ctacagcacgaccaccggaggccgcacccgcagcccccgcagccgccgccgccgcaagag
aggaccaagcccagcttccacgccgccgagcccaaggcccaccacgagccggccgagcgg
gcccgggaggtggaagatagatttaggaaaactaaccacagctcccctgaagcccagtct
aagcagacaggcagagtattggagccaccagtgccttccagatcagagtctttttccaat
ggcaactccgagtgtgtgcaccctgccctgcagagaccagccgagccacaggtacagtgg
tcccacctggcgtctctcaagaacaatgtttcccctgtctcgcgatcccattccttcagt
gacccttctcctcccaaatttgcacaccaccatcttcgctctcaggacccatgtccacct
tcccgcagtgaggtgctcagtcagagttctgactctaagtcggaggtacctgagcccacc
caaaaggcttggtctagatcagacagtgacgaggtgcctccaagggtccctgtgagaaca
acgtctcggtcccctgtcctgtcccgtcgggactccccgctgcagggcagtggacagcag
aacagccaagcaggtcaaaggaactccaccagcatcgagccccggctgctgtgggagaga
gtggagaagctggtgcccaggcctggcagcggcagctcctcggggtccagcaactcagga
tcccagcccggctcccaccccgggtcccagagcggctccggggagcgcttcagagtgaga
tcatcgtccaaatctgagggctctccatctcagcgccttgaaaatgcagcaaaaaagcct
gaagacaaaaaagaagttttcaggcctctcaagcctgctggcgaagtggatctgacggcg
ctggccaaagagctgcgggcagtggaagacgtgcggccaccacacaaggtgacagactac
tcctcctccagcgaggagtcggggacgacggatgaggaggacgacgacgtggagcaggag
ggcgcggaggagccgggctctggaccggaggacccccgagcagcgtcatctctgaatttg
agcaacggggaaacggagtccgtgaaaaccatgattgtccacgacgacgtggaaagcgaa
ccagccatgaccccgtccaaggagggcaccctgatcgtccgccagagtacagttgaccaa
aagcgcgccagccatcatgagagcaatggctttgccggtcgcattcacctcttgccagat
ctcttacagcaaagccattcctcctccacttcctccacctcctcctccccatcctccagc
cagccgacacccaccatgtccccacagacaccccaggacaagctcactactaatgagact
cagtccgctagtagcacactccagaaacacaaatcttcctcctcctttacaccttttata
gaccccagattactacagatttctccatcgagtgggactacagtgacctctgtggtggga
ttttcctgtgatggaatgagaccagaggccataaggcaagatcctacccggaagggctca
gtggtcaatgtgaaccccaccaacactaggccacagagcgacaccccggagatccgcaag
tacaagaagagatttaactccgagattctctgtgctgccctgtggggagtgaatttgttg
gtgggtacagagagtggcctgatgctgctggacagaagtggccaagggaaggtgtatcct
ctgattaacagaagacgatttcaacagatggacgtcctggaaggcttgaatgtcttggtg
acaatatctggcaaaaaggataagttgcgtgtctactatttgtcctggttaagaaataaa
atacttcacaacgacccggaagtcgagaagaagcagggctggacaaccgtaggggatttg
gaaggatgtgtgcactataaagttgtaaaatacgaaagaatcaagtttctggtaattgct
ctgaagagttctgtggaagtgtatgcatgggcacccaagccataccacaaatttatggcc
tttaagtcgttcggagagctggtgcataagccattgctggtggatctcactgtggaggaa
ggccagaggctgaaagtgatctacgggtcctgtgcagggttccatgctgtggatgtggac
tcgggatctgtctatgacatttatctaccaacacacgtaagaaagaacccacactctatg
atccagtgcagcatcaaaccccacgcgatcatcatcctccccaacacggacggcatggag
ctcctggtgtgctacgaggacgagggggtgtacgtgaacacctacgggaggatcaccaag
gacgtggtcctacagtggggcgagatgcccacgtccgtggcatacattcgatccaaccag
acaatgggctggggagaaaaggccatagagatccggtctgtggaaactggccacttggac
ggcgtgttcatgcataaaagggctcagaggctgaagttcttgtgtgagcgcaatgacaag
cagcaagagcacttctgcaggtggggcccgagggcatcgaagccccaattaacaccttcg
ttttcccatcctgaccatatccttgtcctccccgggacctgctccctcccgcccacggcc
agctctggagtggagcggacagctggctgggatgctgacaccctgggcctgttttga

DBGET integrated database retrieval system